KEGG   Brachyspira pilosicoli WesB: WESB_2122Help
Entry
WESB_2122         CDS       T02412                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpw01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpw00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2360217..2361083
Genome map
AA seq 288 aa AA seqDB search
MSKTIRLIYPQWQGGIISHWISELKPEDSSRGYYLGAKLLSILAPQNDNHKTLEVPVSLD
IKNREIKNGIMDYDFIVSQTKNALDILNKNNPDKIITFGGECSVSVVPFTYLNKKHDNNV
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKNISSILPSKISSDRILFVGLRDWE
RDDIKKRQEEYGIPHFAPEEASSENIINWLKKSNASKVLIHFDLDVIDPNEIIAAVGVSP
NGMKINETVRIINYIAKEREIVGFTIAEHMPRIEIMLKNMMEDLDLFK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattgatttatccgcagtggcagggcggtattatttctcattgg
atatctgaactaaagcctgaagattcttcaagaggttattatcttggtgcaaaattacta
agcatacttgctcctcaaaatgataatcataaaactttagaagttcctgtttctttagat
ataaaaaatagagaaataaaaaatggtattatggattatgattttatagtatctcaaact
aaaaatgcattggatattttaaataaaaataatcctgataaaataataactttcggagga
gagtgttctgttagtgtagtgcctttcacatatctaaataaaaaacatgataataatgtt
gctttaatttggatagatgctcaccctgatattactttgcctgaagataatacttatgct
ggatatcatgctatggctgttagtgcttgtatgggtaatgttgataaaaatataagctct
atacttccaagcaaaatttcatctgatagaatattatttgtagggcttagagattgggaa
agagatgatataaaaaaacgtcaagaagaatacggcatacctcattttgctcctgaagaa
gcttcaagcgaaaatataataaattggctgaaaaaatctaatgcttctaaggttttgata
cattttgatttggatgttattgaccctaatgaaataatagctgctgttggcgtttctcca
aatggaatgaagataaacgaaacagtaagaataataaattatattgccaaagaaagggaa
attgtcggctttactatagcagaacatatgccaagaattgaaataatgcttaaaaatatg
atggaagatttagacttatttaagtaa

DBGET integrated database retrieval system