KEGG   Brachyspira pilosicoli WesB: WESB_2260Help
Entry
WESB_2260         CDS       T02412                                 

Definition
(GenBank) pyruvate oxireductase
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WESB_2260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WESB_2260
   00020 Citrate cycle (TCA cycle)
    WESB_2260
   00620 Pyruvate metabolism
    WESB_2260
   00640 Propanoate metabolism
    WESB_2260
   00650 Butanoate metabolism
    WESB_2260
  Energy metabolism
   00680 Methane metabolism
    WESB_2260
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WESB_2260
Enzymes [BR:bpw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WESB_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2505110..2506141)
Genome map
AA seq 343 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKS
FVRFSETEVRVNSTVEEPHVVAVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCIDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAEL
VEPNIEAFRKGGSESVVKEFKADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDL
QVTRTGNIPVFNPANCIDCANCEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGC
LKCVRACPKGPYSGKFEKDQQALRIEVEANCDVDKLTYRRYKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggatttttcgagatccgtctcgaaagtatcggt
ggaatgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggt
ttctatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatct
tttgtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgta
gtggcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaa
gatgctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaa
ttacatggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaactt
ccttcacaagctgctaatactatcataatgggtgctatggttaatcagcttgattttata
gattctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaatta
gttgagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattc
aaagctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaa
aataaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagattta
caagttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgct
aactgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaa
gaccctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgt
ttaaaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcag
caggctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgt
tataaaaaataa

DBGET integrated database retrieval system