KEGG   Burkholderia phenoliruptrix: BUPH_00348Help
Entry
BUPH_00348        CDS       T02300                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpx00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpx00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bpx00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:206040..206954
Genome map
AA seq 304 aa AA seqDB search
MNYASILEQIHRDLRPYLGTGKVADYIPQLAKVPADSFGMAIVTASGEVFRIGEADTRFS
IQSISKLFACTMAFRLLGDALWQRVGREPSGNAFNSLVQLEAEHGKPRNPFINAGALIVT
DVLCRRFVQAETALVEFMRRLTGETSIDYDSRVAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVVPATGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDANGNSLAGVLALEWLTTYTG
KSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatccattctcgaacagattcatcgcgacttgcggccttatctgggcacc
ggcaaggtcgcggattacattccgcaactggcaaaagtccccgccgacagcttcggcatg
gcgatcgtcacggcatcgggcgaagtattccggatcggcgaagccgacacgcgtttttcc
attcagagtatttccaagctattcgcctgcaccatggcgttccgcctgctcggcgacgcg
ctgtggcaacgtgtcggccgcgagccgtcgggcaatgctttcaattcgctggtgcaactc
gaggcggagcacggcaagccgcgtaatccctttatcaatgcaggggcactgatcgtcacc
gatgtactgtgccggcgtttcgtgcaagccgaaaccgcacttgtcgaattcatgagacgc
ttaacaggcgagaccagcatcgactacgactcgcgcgtcgctcaatcggaattgcagcac
gcgcatcgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatggaaatgccg
ccagaagtcgtggtcgacgcgtattgccggcaatgcgcaatctccatgagttgcgtcgag
ctggccaaagccgcactctttctcacgaatcacggggtggtgcccgccactggcgagcga
attctggatacgagttccgcgaagcgcctctcggcactcatgctgacctgcggcacgtac
gacgccgccggcgacttcgtttaccgcgtcggcttgcccgcgaagagcggcgtgggcggc
ggcatcgtcgcggtgctgcccggagaaatggcggtgtgcgtctggtcacctgggctcgac
gccaatggcaattcactagccggcgtgctcgcactcgaatggctgacgacttatacggga
aagtcaattttctga

DBGET integrated database retrieval system