KEGG   Paraburkholderia phenoliruptrix: BUPH_00348Help
Entry
BUPH_00348        CDS       T02300                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00220  Arginine biosynthesis
bpx00250  Alanine, aspartate and glutamate metabolism
bpx00471  D-Glutamine and D-glutamate metabolism
bpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BUPH_00348
   00220 Arginine biosynthesis
    BUPH_00348
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BUPH_00348
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BUPH_00348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AFT87817
UniProt: K0DT87
Position
2:206040..206954
Genome map
AA seq 304 aa AA seqDB search
MNYASILEQIHRDLRPYLGTGKVADYIPQLAKVPADSFGMAIVTASGEVFRIGEADTRFS
IQSISKLFACTMAFRLLGDALWQRVGREPSGNAFNSLVQLEAEHGKPRNPFINAGALIVT
DVLCRRFVQAETALVEFMRRLTGETSIDYDSRVAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVVPATGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDANGNSLAGVLALEWLTTYTG
KSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatccattctcgaacagattcatcgcgacttgcggccttatctgggcacc
ggcaaggtcgcggattacattccgcaactggcaaaagtccccgccgacagcttcggcatg
gcgatcgtcacggcatcgggcgaagtattccggatcggcgaagccgacacgcgtttttcc
attcagagtatttccaagctattcgcctgcaccatggcgttccgcctgctcggcgacgcg
ctgtggcaacgtgtcggccgcgagccgtcgggcaatgctttcaattcgctggtgcaactc
gaggcggagcacggcaagccgcgtaatccctttatcaatgcaggggcactgatcgtcacc
gatgtactgtgccggcgtttcgtgcaagccgaaaccgcacttgtcgaattcatgagacgc
ttaacaggcgagaccagcatcgactacgactcgcgcgtcgctcaatcggaattgcagcac
gcgcatcgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatggaaatgccg
ccagaagtcgtggtcgacgcgtattgccggcaatgcgcaatctccatgagttgcgtcgag
ctggccaaagccgcactctttctcacgaatcacggggtggtgcccgccactggcgagcga
attctggatacgagttccgcgaagcgcctctcggcactcatgctgacctgcggcacgtac
gacgccgccggcgacttcgtttaccgcgtcggcttgcccgcgaagagcggcgtgggcggc
ggcatcgtcgcggtgctgcccggagaaatggcggtgtgcgtctggtcacctgggctcgac
gccaatggcaattcactagccggcgtgctcgcactcgaatggctgacgacttatacggga
aagtcaattttctga

DBGET integrated database retrieval system