KEGG   Paraburkholderia phenoliruptrix: BUPH_00640Help
Entry
BUPH_00640        CDS       T02300                                 

Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00010  Glycolysis / Gluconeogenesis
bpx00071  Fatty acid degradation
bpx00350  Tyrosine metabolism
bpx00625  Chloroalkane and chloroalkene degradation
bpx00626  Naphthalene degradation
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUPH_00640
  Lipid metabolism
   00071 Fatty acid degradation
    BUPH_00640
  Amino acid metabolism
   00350 Tyrosine metabolism
    BUPH_00640
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BUPH_00640
   00626 Naphthalene degradation
    BUPH_00640
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BUPH_00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFT88101
UniProt: K0DPH6
Position
2:complement(533100..534086)
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGTAPVLRERQMPEPRPAAGQLLIDVHACGVCRTDLHVIDGELAHPKERLIPGH
EIVGTVAALGDGVTGFAAGDRVGVPWTGSTCGHCRYCASGRENLCDEPGFTGYTIDGGYA
ERTVADSRYCLHLPERYADVEAAPLLCAGLIGYRTLSMARDARAIGIYGFGAAAHIVAQV
ALHQGRTVFALTRPGDTAAQQFALRLGVQWAGGSDETPPEQLDAALIFAPAGPLVPAALK
AVAKGGVVVCGGIHMSDIPSFPYALLWGERRVCSVANLTRADGHAFMQLAADVPLDIETT
PYALADANRALNDLRDGSVNGAAVLCMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaatggtgttcgacgggaccgctccggtgctgcgtgaaaggcagatgcccgag
ccgcggccggccgcgggtcagttgctgatcgacgttcacgcatgcggcgtgtgccgcact
gacttgcacgtgatcgacggggaactcgcgcatccgaaagagcgcctcattcccggacat
gaaatcgtcgggaccgtggcggcgctgggcgacggcgtcacgggcttcgcggcaggcgat
cgcgtcggcgtgccgtggacaggctctacctgcggccactgccgctattgcgcgagcggc
cgcgagaatctatgcgacgagcccggcttcacgggttacacgatcgacggcggttacgcg
gaacgcaccgtcgccgatagccgctactgcctgcacctgcccgagcgctatgccgatgtc
gaagccgccccgcttctgtgcgcgggcctgatcggctaccgcacgctgagcatggcgcgc
gatgcccgcgcaatcggcatctacgggttcggtgcggccgcgcatatcgtcgcgcaagtg
gcgctgcaccaggggcgcacggtgttcgccctgacgcgccccggcgacaccgccgcgcag
cagttcgcgttgcggcttggcgtgcagtgggccggcggcagcgacgagacgcccccggag
caactcgacgcagcgctgattttcgcgcctgccgggccgctcgtgcccgcagcgttgaag
gcggtggcgaagggcggcgtggtggtgtgcggcggcatccatatgagcgatattccgtcg
ttcccgtacgcgctgttgtggggcgagcggcgcgtgtgttcggttgccaacctcacgcgc
gcggatggtcacgctttcatgcaactcgcggcggatgtgccgctcgacatcgagaccacg
ccctatgcactcgcggatgcaaaccgcgcgctaaacgacctgcgcgacggcagcgtcaac
ggcgcggccgtgttgtgtatgcggtag

DBGET integrated database retrieval system