KEGG   Burkholderia phenoliruptrix: BUPH_00668Help
Entry
BUPH_00668        CDS       T02300                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpx00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:565498..566082
Genome map
AA seq 194 aa AA seqDB search
MKLYYSPGACSLADHIAMHEADLQFERVRVDLKTKTTETGRNFDEINPKSYVPTLEFDDG
QRLTENVAILSWVAQRKPSLAPSGELGATRLIEMLAFISTELHKQFGRVFKPTSDAEANA
AREKIGQRFQLIATMLKGDYLFGAEASVADAYLFTMLLWAKKVKIEVPQQLAAFEERMRA
RPAVQLALKHEGIE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattactcgcctggcgcgtgcagtctcgccgatcacattgcgatgcacgaa
gcggatttgcaattcgagcgcgtgcgcgtggacctgaagacaaagacgaccgagaccggc
cggaatttcgacgagatcaaccccaagagctatgtgccgacgcttgaattcgacgatggt
cagcggctcacggaaaacgttgccatcctgtcatgggtcgcgcaacgcaagccttcgctc
gcgccgtcaggcgagctcggcgcaacccggctgatcgagatgctggccttcatctcgacg
gagcttcacaagcaattcgggcgcgtcttcaaaccgacttcggatgcagaagccaatgcc
gcgcgagagaaaatcggccagcgctttcaacttatcgcgaccatgctcaagggcgactat
ctgttcggcgcagaggcaagcgtggcggacgcctatctgttcaccatgcttctgtgggcg
aagaaagtcaaaatagaggtaccgcaacagctcgccgcattcgaagagcgcatgcgcgcg
cggcccgcggtgcagctcgcgttgaaacatgaagggatcgaatga

DBGET integrated database retrieval system