KEGG   Burkholderia phenoliruptrix: BUPH_00881Help
Entry
BUPH_00881        CDS       T02300                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BUPH_00881
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BUPH_00881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:798940..799578
Genome map
AA seq 212 aa AA seqDB search
MTSSKRENTPPAAADGRPSREEAEAAVRVLLRWAGDNPEREGLVDTPARVVRAYEEFFAG
YQVDPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPGHRVVGISK
LARLVDAFAKRLQIQEKMTVQIADTLNEVLQPAGVGVILEAAHQCMSTRGVHKAGVTMVT
SRMLGTFRTDPSTRREFLSIVGNPGAVAVPNT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcagcaaaagagaaaacaccccgcccgcggccgccgacggccgtccgagccgc
gaagaagcggaagccgccgtgcgcgtgctgctgcgttgggccggcgacaacccggagcgc
gagggtctcgtcgacacgccggcgcgcgtggtgcgcgcctatgaagagttctttgccggc
tatcaggtcgatccgcgcgacatcctcgcccgcacgttctcggaagtggacggctacgac
gagatgatcgtgctgaaggacatccgcttcgaaagctattgcgagcatcacatggtgccg
atcatcggccgcgcgcacgttgcgtatctgccggggcatcgcgtggtcggtatttcgaag
ctggcgcgcctcgtcgacgcgttcgcgaagcgtctgcagattcaggaaaagatgaccgtg
cagatcgccgatacgcttaacgaggtgctgcaaccggcgggcgtcggcgtgattctggag
gccgcgcatcagtgcatgtccacgcgcggcgtgcacaaggccggcgtgacgatggtcacc
tcgcgtatgctcggcacgtttcgcacagacccatccacgcgccgcgaattcctgtcgatt
gtcggcaaccccggcgcggtcgccgtgccgaacacctga

DBGET integrated database retrieval system