KEGG   Burkholderia phenoliruptrix: BUPH_01044Help
Entry
BUPH_01044        CDS       T02300                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpx  Burkholderia phenoliruptrix
Brite
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BUPH_01044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:986071..986928
Genome map
AA seq 285 aa AA seqDB search
METGDHAVLLLHGLSSSPLELRFLARLLADEGFVTHTPELPGYSAGTGHQPMEQWISAAV
AEFDKLAARHRHVSVCGLSMGATLAAALAHERPAARALLLLSITLSYDGWAIPWYRFLLD
YVYYTPMRSRYRYREHEPYGLRNEALRSKIARAMQKNDISEVGPASISMPALHEAGRLAG
WVRKKLKGVRTDCLILHAIDDETSSPHNARFVGTHIGASFLRTIWLDDSYHMITSDNERE
VVARECALFLRESVAATVSSTTPTPVISRALARRLRQLATVARKE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccggcgatcacgccgtcctgctgctgcacggtctgtcgagctcgccgctggag
ctgcgctttctcgcccgccttctcgccgacgagggcttcgtcacccatacgcccgagttg
cccggctacagcgcaggcaccggacatcagccgatggagcagtggatcagcgccgccgtc
gccgagttcgacaagctcgccgcgcgccaccgccatgtctccgtctgcggtctctcgatg
ggcgccaccctcgccgccgcgctcgcgcacgaacggccggccgcgcgcgccttgctgctg
ctgtcgatcacattgagctacgacggctgggcgatcccgtggtaccgctttctgctggac
tacgtctattacacgccgatgcgctcccgttaccgctaccgcgagcacgaaccgtacggc
ctgcgcaacgaagcgttgcgctccaagatcgcgcgcgcgatgcagaagaacgacatcagc
gaagtcggacccgcgtccatcagcatgccggcgctgcacgaggccggccggctggcgggc
tgggtgcgcaagaagctgaagggcgtccggacggactgcctgattctccatgccatcgac
gacgagacctcgagtccgcacaatgcgcgattcgtcggcacgcacatcggggcttctttt
ctgcgaaccatctggcttgacgactcctatcacatgatcacgtccgacaacgagcgcgaa
gtcgtcgcgcgcgaatgtgcgctttttctgcgggaaagcgtggcggccaccgtctccagc
acgacacccacgccggtgatctcgcgcgcgcttgcgcgccgcctgcggcaactggcgacc
gtagcgaggaaagaatga

DBGET integrated database retrieval system