KEGG   Burkholderia phenoliruptrix: BUPH_01068Help
Entry
BUPH_01068        CDS       T02300                                 

Definition
two-component system, chemotaxis family, response regulator CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpx02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bpx02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1011542..1012531)
Genome map
AA seq 329 aa AA seqDB search
MAHRDIVVIGASRGALPVLRKLVAGLASDLDASVCIVLHIGRHHSILPELLSRAGPLKAS
HPQQGERMQRGRIYIAPPDRHMVVRDGQFRLLDTAAENFARPAADPLFRSAAAEYRKRVV
GVVLSGDLDDGAAGLAAIRARGGYAVVQRPDDSEAPSMPRSALAAAGADAVASLDDLPQV
LHAAVQGAAPREEHPMTNRPDLDREAQLGESLTVLPEQLDEIGERSALTCPSCNGVLWRM
YDERPLRYRCHTGHAFSSLTLEEATEQSAEDAVWGAIRAVHERIIFARERQRWAERAGND
VEKAVEQARIDENEKLAEILRSATRVQEP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctcatcgcgacattgtagtgatcggagcatcgcgtggcgcgcttcccgtgctcaga
aaactggtggcaggccttgcttccgatcttgacgcatcggtttgtatcgtgctgcacatc
ggccgacatcacagcatactgccggaacttctctcgcgcgccggtccgctgaaggcaagc
catccgcagcaaggcgagcggatgcagcgaggcagaatctacatcgcgcctccggatcga
cacatggtggtgcgcgacggccaattccggctgctcgatacggcggccgaaaactttgcg
cgtccggcggcggaccccttgttccgctcagccgccgccgagtaccgcaaacgtgtggtg
ggcgtcgtgctgagcggcgatctcgacgacggcgcggcgggtctcgccgccattcgcgcg
cgcggtggctatgcggtggtgcagcgccccgacgattccgaggcgccttccatgccgcgc
agcgcgctggccgcggcgggcgcggacgccgtcgcgagtcttgacgatctcccacaggtt
cttcatgctgcggtgcagggagcagcaccgcgcgaggagcatcccatgaccaatcggcct
gatcttgaccgcgaggcacagctgggcgaaagcctgacggtcttgccggagcaactggat
gagatcggtgagcgctcggcgctcacgtgcccgagttgcaacggcgtcctctggcgaatg
tacgacgagcggccattgcgttaccgctgccacacggggcacgcgttttcctcactgacg
ctcgaagaggcgaccgagcagagcgccgaggacgcggtctggggcgccatccgtgcggtg
catgagcggatcatcttcgcgcgcgaacggcagcgctgggccgagcgcgcgggcaacgat
gtggagaaggcggtcgagcaggctcgcatcgacgaaaacgagaagctggccgaaattctg
cgcagcgccacgcgcgtccaggagccctga

DBGET integrated database retrieval system