KEGG   Burkholderia phenoliruptrix: BUPH_01070Help
Entry
BUPH_01070        CDS       T02300                                 

Definition
two-component system, chemotaxis family, CheB/CheR fusion protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BUPH_01070
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BUPH_01070
Enzymes [BR:bpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BUPH_01070
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BUPH_01070
Two-component system [BR:bpx02022]
 CheA family
  CheA-CheYBV
   BUPH_01070
Bacterial motility proteins [BR:bpx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BUPH_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1012942..1017006)
Genome map
AA seq 1354 aa AA seqDB search
MEMAFVVVVHLPSEHASHFDAILQRTTGMPVRQVTATMPLEKNHIYVIAPGKRLEMSDGC
LRTLDQEHSPGPAFAIDHFFRTLADAHDRHAIGIVMSGAGSDGAAGLSRIKEAGGITLAQ
TPGDAEHAEMPQHAIATGQVDIVLPASEMPQRLLELWSNAQRIQLQDLEGPEASNDTGKA
LVNDPERALSDILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLMGYRDFLRATPD
EAHALLGDMLIGVTQFFRDPDAFEYLGREVIASLFAEQPPDGQVRVWVAGCATGEEAYSI
SLQLAQAREKAASGRSIQVFATDIDEAAIARARTGSYPLAIASDVPAPLLQRYFTREGAH
YVVTKAVRERILFAPHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILELFHFALRPNGY
LFLGTAESADAADDLFVVVDKKWRIYRARAVTHRAKPAMGFPPLLQTDVGASDERAVPLP
LSRQPASPAQRNFSYAELHQRALETYSPPSVIIDRESNVVHLSDNAGRFLRHVGGELSSN
IMTLVLPDLRLDLRTAIFRALQTRTSVEARRVKWVHDGQVSWINMTVRPFHDAVANAEFL
LIVFDEVAGHMTDEEQAEATGQDPVLAQLEQELQHSREQLATIIEQYETSVEELKASNEE
LQAINEELRSTSEELESSKEELQSVNEELTTANAEMQARIEDTAKANDDLHNIIASSEIA
TVFVDKEIRVKRFTPNATAIFNLIDSDLGRSLFHITHTLRYPTLADDVRQSFQSLRLTER
EIQSEAGRWYLMRLLPYRTADDHIDGAVITLIDITDRHEAEEAARAGERRLRLVAQSTKD
YAIVIQDSAGTIVSWNAGAERIFGYSEGEVVGENIELIYEHNDRQALLPAQERDIAAKEG
RADDERWHRTKDGRRIFCSGVVTPIVDTSFNGFAKILRDLTARKQREDASREALAREQAA
REQALSANQLKDEFIAVLSHELKHPLNLIGVKAEMLPRLPEVRHLPAVWDAAASIRHAVR
SQAQIIDDLLDLSRIQTGKLALEVSRVDLAALIADIADTCEEDAHARGVALQVEVADEPA
ITLADPVRCEQILWNLLSNAMKFTDSGGRVEVRLSRDGRMLRLEVTDSGQGIEPATLPYI
FDMFRQTPRGRSRGGLGIGLALVRQLVEMHGGHVKAESEGPGHGTRMTVWLPAMEDERGQ
LRDAIGKHRTIAGLHILLVEDDAETATSLTALLELEGARVRTAGDGLEALRMLAEEPADA
VVSDIGMPHMDGYELMRKIRSDPAVSGVRAIALTGRNRHDEVQAAHEAGFNAHLAKPLEF
QQLLDELGALTPDGRAAGENRRAQLAPDARRTGK
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atggagatggcgtttgtcgtcgtcgtgcatctgccgtcggaacacgccagtcacttcgac
gcgatcctgcaacgcacgacaggcatgccggtgcgccaggtgacggccaccatgcctctg
gagaaaaaccatatatacgtgatcgctccgggcaagcggctcgaaatgtccgacggctgc
ctccggacgctcgaccaggaacactctcccggaccggctttcgcgatcgaccattttttc
cgcacgctcgcggacgcgcacgaccggcacgcaatcggcatcgtcatgtccggcgcgggg
tcggacggcgccgcgggactgagccgcatcaaggaagccggcggcattacgctggcccag
acgccgggcgacgccgagcacgccgagatgccccagcatgcgatcgccaccggccaggtc
gacatcgtgctgccggcctccgaaatgccgcagcggctgctggagctgtggagcaacgcg
cagcgcatccagcttcaggacctcgaaggcccggaggcgtcgaacgacaccggcaaggcg
ctcgtcaacgatccggaacgggcgctctccgacatcctcatgcacttgcgcgtacgcacc
ggccacgatttccggctatacaagcgagccacggtgcttcggcgcatcgagcggcgcatg
caggtgaacggccagcgcgatctgatgggctaccgcgacttcctgcgcgcaacgcccgac
gaggcgcatgcactgctcggcgacatgctgatcggcgtcacgcagtttttcagggacccg
gacgcgttcgaatatctcggccgcgaagtgattgcctcgctattcgccgaacagccgccg
gacggccaggtgcgagtgtgggtcgcgggctgcgcgaccggcgaggaggcttactcgatc
tcgctgcaactcgcgcaggcacgcgaaaaagccgcatcgggccgctccattcaggtcttc
gcgacggacatcgacgaagcggcgattgcccgcgcgcgtaccggttcgtatccgcttgcc
attgcgagcgacgtgccggcgccgctgctgcaacgctatttcacgcgggaaggcgcgcat
tacgtcgtgaccaaggccgtgcgcgagcgcattctcttcgcgccccacagtctgctgcgc
gatccgccgttttcgcatctcgatctgatttcgtgccgcaacgtgctcatttatctggag
cgcgcggtgcagcggcagattctcgaactcttccacttcgcgctgcgcccgaacggttat
ctgttcctcggcacggcggagtcggctgacgcggccgacgatctcttcgtcgtcgtggac
aagaagtggcgcatctaccgtgcgcgcgccgtcacccatcgcgccaagccggcaatgggc
tttccgccgctgctgcagaccgacgtcggcgcgagcgacgagcgggcggttccgctgccg
ctttcgcgccaaccggcgagtcccgcgcagcgcaacttctcttacgcggagctgcatcag
cgcgcgctcgaaacgtattcgccgccgagcgtgattatcgaccgcgaatcgaacgtggtg
catctgtcggacaacgcggggcgcttcttgcggcacgtcggcggcgagttgtccagcaac
atcatgacgctcgtgctgcccgacctgaggctcgacctgcgcacggccattttccgggcg
ctgcaaacgcgcacgagcgtggaagctcgccgcgtgaaatgggtgcacgacggccaggtt
tcatggatcaacatgacggtgcggccgtttcacgatgccgtcgccaatgcggagtttctc
ctgatcgtattcgacgaagttgccggccacatgaccgacgaagaacaggccgaagcgacc
ggccaggaccctgtgctcgcccagctcgagcaggagttgcagcacagccgcgaacaactg
gcgacgatcatcgagcagtacgaaacgtcagtggaagaactgaaggcgtcgaacgaggaa
ctgcaggcgatcaatgaagaactgcgctccacgagcgaagagctcgaaagcagcaaggag
gagttgcagtcggtcaacgaggagttgaccaccgcgaacgcggagatgcaggcgcgaatc
gaagacacggccaaagccaacgacgatttgcacaacatcatcgcgtcgagcgaaattgcc
acggtgttcgtggacaaggaaatcagggtcaagcggttcacgccgaacgcgacggccatt
ttcaatctgatcgactccgacctcgggcgctcgctgttccacatcacgcatacgctgcgc
tatccgacgctcgccgacgacgtcaggcagtcgttccagtctctgcggctgaccgagcgc
gagattcagagcgaggcgggccgctggtatctgatgcggctcctgccttatcgcacggcg
gacgatcatatcgacggcgcggtgatcacgctgatcgacatcaccgaccgtcacgaagcc
gaggaagccgcgcgggcgggcgagcggcgcctgcgcctcgtcgcgcaatcgacgaaagac
tacgcgatcgtgattcaggattccgccggaacgattgtgagctggaacgcgggcgccgaa
cggattttcggctattcggaaggcgaagtggtcggcgagaacatcgagctgatctacgag
cacaacgaccgccaggcgctgctgcccgcgcaggagcgcgacatcgccgcgaaggaaggc
cgcgccgacgatgagcgctggcaccgcacgaaagacggccgccgcatcttctgcagcggt
gtggtgacgccgattgtcgatacgtcatttaacggcttcgcgaagattctgcgcgatctg
acggcgcgcaaacagcgcgaggacgcgagccgcgaagcgctcgcccgcgagcaggcggcg
cgcgagcaggcgctgagcgcgaaccagttgaaggacgagttcatcgccgtgctgtcgcac
gagttgaaacatccgctcaatctgatcggcgtgaaggcggaaatgcttccgcgcttgccg
gaagtgcgccacctgcctgccgtgtgggacgcggctgcgtccatccggcacgcggtgcgc
agccaggcgcagatcatcgacgatctgctcgatctctcgcgaatccagaccggcaagctc
gcgctcgaagtctcgcgggtcgatctggcggctttgatcgcggatatcgccgacacctgc
gaggaagacgcgcacgcccgcggcgtcgcgctgcaggtcgaggttgcagacgagccggcc
atcacgctggccgacccggttcgttgcgagcagattctctggaacctgctgtccaacgcc
atgaagttcaccgattccggcggacgcgtggaggtgcgtctgtcgcgcgacggccgcatg
ctgcgtcttgaagtcaccgacagcggccagggcatcgagccggccacgctgccttacatc
ttcgatatgttccgccagacgccgcgcggccgcagtcgcggcggtctcggcatcggcctc
gcgctcgtgaggcagcttgtcgagatgcacggcggccacgtcaaggcggagtcggagggt
ccgggccacggcaccagaatgacggtatggctgcccgccatggaagacgagcgcgggcag
ttgcgcgacgccatcggcaagcaccgtactatcgccggcttgcacatcctgctggttgag
gacgatgcggaaacggctacctcgctgaccgcgctgctcgagctcgaaggagcgcgcgtc
aggaccgccggcgacggtctggaggcgctgcggatgctggcggaggaaccggccgacgcg
gtcgtgtccgacatcggcatgccgcacatggacggctacgagctgatgcgcaagatcagg
tccgatccggccgtcagcggtgttcgcgcgattgcgctgaccgggcggaaccggcacgac
gaggtccaggccgcgcatgaggcgggattcaacgctcatctggcgaagccgctggaattc
cagcaattgctggatgaactcggcgcgctgacgccggacgggcgagccgcaggcgagaac
cggcgcgcacagctggcgccggacgcgcgacgcaccgggaagtga

DBGET integrated database retrieval system