KEGG   Paraburkholderia phenoliruptrix: BUPH_01271Help
Entry
BUPH_01271        CDS       T02300                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00010  Glycolysis / Gluconeogenesis
bpx00520  Amino sugar and nucleotide sugar metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUPH_01271
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_01271
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BUPH_01271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Tex_YqgF Hexokinase_1 Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AFT88723
UniProt: K0DXH1
Position
2:complement(1263639..1264439)
Genome map
AA seq 266 aa AA seqDB search
MATSKDKAATSNERILAIDVGGTGLKAAIINANGEMQTERVRVATPHPCTPEQLVDALAA
LVQPLIAKAPAQLMSIGFPGVVRDNRILTAPHFGVEGWHGFALADLLAQKLGGLPVRMIN
DAEMQGFAAIEGKGIEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKKGVAYDEYIGEA
AREKAGNKRWNRRVHKVIGILESLVNYDKLWIGGGNAARLKFELPANVATVSNDAGIEGG
ARLWHPRSVRETRQLPEANARTGKFK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacatccaaagataaagcggcaaccagtaacgaacggattcttgcaatcgacgtc
ggcggcacgggtctgaaagcggccatcatcaacgcgaatggcgagatgcaaaccgaacgc
gtgcgggtcgcgacgccgcatccgtgcacgccggaacaactcgtcgatgcgctggccgca
ctcgtccagccgctgatcgcgaaggcgccggcgcagctgatgtcgatcggctttcccggc
gtggtgcgcgacaaccgcattttgacggcaccgcatttcggcgtggaaggctggcacggc
tttgcgctcgccgatctgctcgcgcaaaaactcggcggcttgcccgtgcgcatgatcaac
gacgctgaaatgcagggctttgcggcaatagaaggcaagggcatcgaatttgtgctgacg
ctcggcaccggcgcgggcacggcgctctttcgcgacggcgaactgatgccccatctcgag
cttgcgcatcatccggtcagcaagaaaggcgtggcttacgacgagtacatcggcgaggcc
gcgcgcgaaaaagcagggaataaacgctggaaccggcgcgttcataaggtgatcggcatt
ctcgaatcgctcgtgaattacgacaaattgtggattggcgggggcaatgcggcgcgcctc
aagttcgagctgcccgccaacgtggcgaccgtctcgaacgatgcgggcatcgagggcggc
gcgcggctgtggcatccgcggtcggtgcgcgaaacccgtcagttgcccgaagcgaatgcg
cgcacgggcaagttcaaatga

DBGET integrated database retrieval system