KEGG   Burkholderia phenoliruptrix: BUPH_01456Help
Entry
BUPH_01456        CDS       T02300                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_01456
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_01456
   00650 Butanoate metabolism
    BUPH_01456
  Energy metabolism
   00190 Oxidative phosphorylation
    BUPH_01456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1489890..1490258
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRITACVMALYTVILLAWFFGARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGVRLLLQALTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggctcgaagcgtctggtggtgggcgcgcactacggtctg
cgcgactggctcgcgcagcgcatcaccgcctgcgtgatggccctctacacggtgatcctg
ctcgcgtggttcttcggcgcgcgcgacttctcctacgaaggctgggcctcgatcttcgcc
acccagtggatgaagctcgccaccttcgtcacgctgctctcgctcttctatcacgcgtgg
gtcggcatccgcgacatctggatggactatgtgaagcccgtgggcgtgcgtctgctgctg
caggcgctgaccatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system