KEGG   Burkholderia phenoliruptrix: BUPH_01484Help
Entry
BUPH_01484        CDS       T02300                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BUPH_01484
Enzymes [BR:bpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BUPH_01484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1522386..1524587)
Genome map
AA seq 733 aa AA seqDB search
MSTRRSGDTIATLATRAGFEVEWEDAHHKVHRVPEKTLAMLLERMGLPCGNATQIRQSAA
ALEAELSGRKLPPLMTAEVGRGIALPAAAIRSGSHYRIELESGSIIDGRFTAPKGEEALL
APIDEPGYHTLVIHEQRMTLAVAPSRCYTVADAWRSLHDDDARADAPPLWGMAAQLYGLR
RVGDGGIGDYSALARIAVESARRGAHALAVSPTHAMFSAEPNRFSPYSPSSRLWLNVTHI
DPAAVFGEDTLRAAMQSTGAADAWTELEGLPLIDWPKAVVLKLKLLRALFENFCTEERAH
DAPRALEFHGFCERAGRALEDHARFEALQAAQLAKGGNGHWRDWPEALRDPRSPEVEAFA
QAQRHEVDFHLFLQWLAAKGLSHAQHAAREAGMAVGLIADLAVGCDSAGSHAWSYRDDML
QGVSVGAPPDLFNQAGQSWGLTTFSPRAMRTQGFSAFIDMLRAAFAHAGGIRIDHILGLR
RLWLVPEGESARNGAYLRYPLEDLLRLIALESWRHRAIVIGEDLGTVPPGFRERLDEHGI
AGIRVLWFERDEDGSGFKPPQAWDRNAVGTTTTHDLPTVAGWWAGSDIAWRNRIGQTMAR
PDGRDPEEAAQEERASDRAELWRAFQQAGVAAPDVPAPPPESPPVDEALAFVAATPGPLV
TFPLEDLLAHSEQPNLPGSIDEHPNWRRRMNLPIDEMFLDDTFCDRLLAVDRARRAATVA
TPPANPASEPDTP
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacccgacgttccggcgatacgatcgccaccctcgcgacgcgcgcgggcttcgag
gtggaatgggaagacgcgcatcacaaggtgcaccgcgtgcccgagaagacgctcgccatg
ctgctcgaacggatgggcctgccgtgcggtaacgcgacgcagatccgtcaaagcgcggcc
gcgctcgaggccgaactgtccggccgcaaactgccgccactgatgaccgccgaagtcggc
cgcggcattgccttgccggccgccgcgatcaggtcgggcagccactaccggatcgagctg
gagagcggctcgatcatcgacgggcgctttaccgcgcccaaaggcgaagaagcgctgctc
gcgcccatcgacgaacccggttatcacacgctcgtgattcacgagcagcgcatgacgctc
gcggtcgcgccgtcacgctgctacaccgtcgccgacgcatggcgcagtctgcatgacgac
gacgcacgcgccgacgcaccgccgctgtggggcatggccgcgcaactctacggcttgcgt
cgcgtgggcgacggcggcatcggcgactattcggcactcgcgcgaatcgcggtggaaagc
gcgaggcgcggcgcgcatgcgctcgccgtcagtccgacgcacgcaatgttcagcgcggag
ccgaaccgcttcagcccgtattcaccgtcgtcgcgtttgtggctgaacgtcacgcatatc
gacccggcggccgtgttcggcgaagatacgttgcgcgccgcgatgcagtccaccggggcc
gccgacgcgtggaccgaactcgaaggcttgccgcttatcgactggcccaaggccgtcgtg
ctcaagctgaaactcttgcgcgcgctgttcgaaaacttctgcacggaggaacgcgcgcac
gacgcgccgcgcgcgttggaatttcacggtttttgcgaacgtgccggacgagcgctcgaa
gaccatgcgcgtttcgaagcgctgcaggccgcgcagctcgcgaagggcggcaacggtcat
tggcgcgactggcccgaagcgttgcgcgatccgcgcagtccggaagtggaggcgtttgcg
caggcgcagcgccatgaagtcgactttcacctctttttgcaatggctcgccgcgaagggt
ctgtcccacgcgcagcatgcggcgcgcgaggccggcatggccgtaggcctgatcgccgat
ctcgcggtgggctgcgacagcgccggcagccacgcatggtcctatcgcgacgacatgctg
caaggcgtgtccgtcggcgcgccgcccgacctcttcaaccaggcgggacaaagctggggg
ctcaccactttctcgccgcgcgcgatgcgcacgcaaggcttctcggcgttcatcgacatg
ctgcgcgccgcgttcgcgcacgcgggcggcatccgcatcgatcacattctcggtttgcgg
cgcctgtggctcgtgccggaaggcgagagcgcgcgcaacggcgcgtatctgcgctatccg
ctcgaagacctgctgcggctcatcgcgctcgaatcgtggcggcatcgcgcgattgtgatc
ggcgaggatctcggcacggtgccgcccggttttcgcgagcggctcgacgagcacggcatt
gccggcatccgcgtgctgtggttcgagcgcgacgaggacggcagcgggttcaagccgccg
caggcatgggaccgcaatgcggtcggcacgaccaccacgcacgatctgccgaccgtcgcc
ggatggtgggccggtagcgacatcgcgtggcgcaaccggattgggcagaccatggcgcgc
cccgacggccgcgatcccgaagaagccgcgcaggaagagcgcgcgagcgaccgcgccgaa
ctgtggcgcgcgttccagcaagcaggcgtagccgcgcccgatgtgcccgcgccgccgccg
gaaagcccgcccgtcgacgaagcgcttgcctttgtcgcggccacgccgggaccgctcgtt
acgtttccgctcgaagatctgctcgcgcacagcgaacagccgaatctgccgggctcgatc
gacgagcatccgaactggcgccgccgcatgaatctgcccatcgacgaaatgtttcttgac
gacaccttttgcgaccggctgctcgcggttgaccgcgcgcggcgcgccgcgaccgttgcc
acgcctcccgccaatcctgcttcggagcctgatacgccatga

DBGET integrated database retrieval system