KEGG   Burkholderia phenoliruptrix: BUPH_01487Help
Entry
BUPH_01487        CDS       T02300                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BUPH_01487
Enzymes [BR:bpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BUPH_01487
Exosome [BR:bpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUPH_01487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1528968..1531178)
Genome map
AA seq 736 aa AA seqDB search
MSEHDPAAGLQPLDIDALVEARHPDPFSQLGLHHTDAGPVVRALLPNAAHVSVIARADGA
PLGELQQLRPGLFAGRVSSAVPYRLRIDWHGVVQEIEDTYSFGPVLGDEPLGRLANGDPY
AVLECLGAHPMEFDGVPGVRFAVWAPNARRVSVVGDFNAWDGRRHPMRLRHQAGVWELFV
PRVGPGTRYKYELLARDGHPLPLKADPCAMQSEKPPGTASVVAHVDEIEQFPWTDHDWIQ
SRGEKQTPRSPVSIYEVHAESWLRVAEEGQRGLDWAELAERLIPYAKTMGFTHVEFLPVA
EHPFGGSWGYQPLGQFAPSARFGKPEQFALFVNKAHEAGLGVIIDWVPAHFPNDAHGLVQ
FDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIASGLAWLKRYHVDGLRVDAVASM
LYRDYSRAAGEWVPNIYGGRENLESIAFLKRLNHEVGYVPGVPGAITIAEESTAWPGVTA
RVEDGGLGFQFKWNMGWMHDTLHYMQEDPVYRQYHHHNMTFGMVYAYSERFVLPLSHDEV
VHGKGSLLGKMPGDTWQKFANLRAYFGFMWTHPGKKLLFMGGEFGQLAEFNHDASPHWHL
LDDAHHHGVQLLVRDLNRLYHDEPALHLLDSEPGGFNWLIGDDSANSVFAYRRTDGAGRE
LVVVCNMTPVPRVGYRIGMPREGRWSEVLNTDASVYGGSNMGNGGVIHTDALASHGWPHS
ASLTLPPLATIVLRAD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacacgatccggccgcaggccttcagccgctcgacatcgacgcgctcgtcgag
gcgcgccatcccgatcctttctcgcagctcgggctgcatcacacggacgcgggtccggtg
gtgcgcgcgttgttgccgaatgccgcgcacgtcagcgtgatcgcgcgcgccgacggcgca
ccgctcggcgaacttcagcagctgcgtcccgggctttttgccggccgcgtgagctcggcc
gtgccgtatcggttgcgcatcgactggcatggcgtcgtgcaggaaatcgaggacacctac
tcgttcggccccgtgctcggcgatgaaccgctcgggcgtctcgcgaacggcgacccgtat
gcggtgctcgaatgcctcggcgcccacccgatggaattcgacggcgtgccgggcgtgcgc
ttcgcagtgtgggcgccgaacgcgcggcgcgtctccgtggtcggcgatttcaatgcatgg
gacgggcgccgtcatccgatgcgtctgcggcatcaggcgggcgtgtgggaactcttcgtg
ccgcgcgtcggcccgggcacgcgctacaagtacgaactgctcgcgcgcgacggtcatccg
ctgccgttgaaggccgacccttgcgcgatgcaaagcgagaagccgccaggcacggcgtcg
gtggtcgcgcatgtcgacgagatcgagcagtttccgtggaccgatcacgactggatccag
tcgcgcggcgaaaagcagacgccgcgctcgccggtctcgatctacgaagtgcatgcggag
tcgtggctgcgcgtcgccgaagagggccagcgcggtctcgattgggccgagctcgccgag
cgcctgattccgtatgcgaaaaccatgggcttcacgcacgtggagtttctgccggtcgcg
gaacatccgttcggcggatcgtggggttatcagccgctcgggcagttcgcgccgtcggcg
cgcttcggcaagccggagcagtttgcgctcttcgtcaacaaggcgcacgaggcagggctc
ggcgtgatcatcgactgggtgcccgcgcattttccgaacgacgcgcacggtctcgtgcag
ttcgacggcacgccgctttacgagcatgccgatccgcgcgaaggctaccaccaggactgg
aacacgatgatctacaacctcggccgcaacgaggtgagcgcgttcctgattgcgtcgggg
ctcgcgtggctcaagcgctatcacgtggacggcctgcgcgtggacgccgtggcgtcgatg
ctctatcgcgactattcgcgcgccgccggcgagtgggtgccgaacatttatggcggccgc
gagaatctcgagtcgatcgcattcctcaagcgcctgaatcacgaggtgggctatgtgccg
ggcgtgccgggcgcgatcaccattgccgaggaatccaccgcgtggccgggcgtgacggcc
cgcgtggaagacggcggcctcggtttccagttcaagtggaacatgggctggatgcacgac
acgctgcattacatgcaggaagatcctgtctatcgccagtaccatcatcacaacatgacg
ttcgggatggtgtacgcgtattcggagcgcttcgtgctgccgctttcgcacgacgaagtg
gtgcacggcaaaggctcgttgctcggcaagatgcccggcgacacctggcagaagttcgcg
aatctgcgcgcgtactttggcttcatgtggactcacccgggcaagaagctgcttttcatg
ggcggcgaattcggccagctcgccgagttcaatcacgacgcgtcgccccactggcatctg
ctcgacgatgcccatcatcacggcgtgcaattgctggtgcgcgacctgaaccgcctctat
cacgacgagcccgcgctgcatctgctcgacagcgagccgggcggctttaactggctgatc
ggcgacgacagcgccaacagcgtgttcgcgtatcgacgcaccgacggcgcgggccgcgaa
ctcgtcgtggtgtgcaacatgacgccggtgccgcgcgtcggctaccgcatcggcatgccg
cgcgaagggcgctggtcggaggtgttgaacacggacgctagcgtgtatggcggctcgaat
atgggcaacggcggcgtgattcacaccgacgcgctagcgagccacggctggccgcattcg
gcctccctgaccttgccgccgctcgccacgatcgtgctgcgcgccgactga

DBGET integrated database retrieval system