KEGG   Burkholderia phenoliruptrix: BUPH_01776Help
Entry
BUPH_01776        CDS       T02300                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BUPH_01776
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BUPH_01776
Enzymes [BR:bpx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BUPH_01776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1435648..1436199
Genome map
AA seq 183 aa AA seqDB search
MGNQVLATALPEVKLIEPEVFGDESGFCYESFSADEFVDDVARGFDFVQDRHLRAVHGVL
RGLHYQVQRPQGRLLQVVVGEIFDVAVDVRLNSPNFGKWCGAYLSAGNHRQVWVPPGFAH
GFVVLSDVAECLWKATEYWFPELERCIVWNDPDIGIEWPIDFQPIVGAKDAAGRRLYEAE
NMP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccaggtgttggcaacggcactaccggaagtgaaactcatcgagcccgaggtg
tttggcgacgaatccggtttctgttacgagagcttcagcgcggacgagtttgtggacgac
gtcgcacgcggattcgacttcgtgcaggaccggcatctgcgcgcggtgcatggcgtgctg
cgcggcctgcattaccaggtgcagcgcccgcaaggccgcctcctgcaggtcgtggtcggc
gagatcttcgacgtcgccgtggacgtgcggctcaattcgccgaacttcggcaaatggtgc
ggcgcttatctgagcgccggcaatcatcggcaggtgtgggtgccgccaggcttcgcgcat
ggcttcgtggtgctgtccgacgtggccgaatgcctgtggaaggccaccgaatactggttt
ccggagctcgaacgctgcatcgtgtggaacgatccggacatcggcattgaatggccgatc
gacttccagccgattgtcggcgcgaaggatgccgccgggcggcggctgtacgaagcggag
aacatgccgtag

DBGET integrated database retrieval system