KEGG   Paraburkholderia phenoliruptrix: BUPH_01907Help
Entry
BUPH_01907        CDS       T02300                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00020  Citrate cycle (TCA cycle)
bpx00310  Lysine degradation
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_01907
  Amino acid metabolism
   00310 Lysine degradation
    BUPH_01907
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BUPH_01907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFT85479
UniProt: K0DPU9
Position
1:1604442..1605719
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGKAGAAAVEAEVKPAPVAAPAPAAAPAAQAASAAGANTAA
SPAAGKLMAEKGLSAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSLPD
VKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctgtccgagtcggtctcggaagccacgatg
ctgcagtggaagaaaaagcccggcgaggctgttgctcaggacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggccgatcaggtgatcgccaagatcgacacggaa
ggcaaggctggcgccgctgccgtcgaagccgaagtgaagccggctccggtcgccgctccg
gcaccggccgctgcaccggctgcgcaagctgcctccgcggcgggtgcgaacaccgctgct
tcgccggctgccggcaagctgatggcggagaagggcctctccgccggcgacgtcgccggc
acgggccgcgacggccgcatcaccaagggcgacgtgctgacggcaggtgcaccggctgcc
aaggctgctgcgccggcaccggccgctgcaccgaaggctgcgaagccgtcgctgccggac
gtgaaggcgcccgcatcggccgatcaatggctgaaagaccgcccggaacaacgcgtgccg
atgtcgcgtctgcgcgcgcgtatcgccgagcgtctgctcgaatcgcagcaaaccaacgcg
atcctgaccacgttcaacgaagtgaacatggcgccggtgatggacctgcgcaacaagtac
aaggacaagttcgaaaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcatgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggtctggtg
gtgccgatcctgcgcaatgcggatcagctgagcctcgccgaaatcgagaagaagatcgcc
gaattcggtcagaaggcgaaggacggcaagctgtccatcgaagaaatgacgggcggtacg
ttctccatctcgaacggcggagtgttcggctcgatgctgtcgacgccgattatcaacccg
ccgcagtccgcgattctcggcgtgcacgccacgaaggaacgcgcggtcgtggaaaacggc
cagatcgtgatccgcccgatgaactatctggcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagacccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system