KEGG   Burkholderia phenoliruptrix: BUPH_01907Help
Entry
BUPH_01907        CDS       T02300                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_01907
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_01907
  Amino acid metabolism
   00310 Lysine degradation
    BUPH_01907
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BUPH_01907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1604442..1605719
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGKAGAAAVEAEVKPAPVAAPAPAAAPAAQAASAAGANTAA
SPAAGKLMAEKGLSAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSLPD
VKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctgtccgagtcggtctcggaagccacgatg
ctgcagtggaagaaaaagcccggcgaggctgttgctcaggacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggccgatcaggtgatcgccaagatcgacacggaa
ggcaaggctggcgccgctgccgtcgaagccgaagtgaagccggctccggtcgccgctccg
gcaccggccgctgcaccggctgcgcaagctgcctccgcggcgggtgcgaacaccgctgct
tcgccggctgccggcaagctgatggcggagaagggcctctccgccggcgacgtcgccggc
acgggccgcgacggccgcatcaccaagggcgacgtgctgacggcaggtgcaccggctgcc
aaggctgctgcgccggcaccggccgctgcaccgaaggctgcgaagccgtcgctgccggac
gtgaaggcgcccgcatcggccgatcaatggctgaaagaccgcccggaacaacgcgtgccg
atgtcgcgtctgcgcgcgcgtatcgccgagcgtctgctcgaatcgcagcaaaccaacgcg
atcctgaccacgttcaacgaagtgaacatggcgccggtgatggacctgcgcaacaagtac
aaggacaagttcgaaaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcatgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggtctggtg
gtgccgatcctgcgcaatgcggatcagctgagcctcgccgaaatcgagaagaagatcgcc
gaattcggtcagaaggcgaaggacggcaagctgtccatcgaagaaatgacgggcggtacg
ttctccatctcgaacggcggagtgttcggctcgatgctgtcgacgccgattatcaacccg
ccgcagtccgcgattctcggcgtgcacgccacgaaggaacgcgcggtcgtggaaaacggc
cagatcgtgatccgcccgatgaactatctggcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagacccggcgcgc
ctgctgctcgacctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system