KEGG   Burkholderia phenoliruptrix: BUPH_02156Help
Entry
BUPH_02156        CDS       T02300                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_02156
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_02156
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_02156
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BUPH_02156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1899752..1901935
Genome map
AA seq 727 aa AA seqDB search
MEQSMTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAE
RDRLQTELDTWHRANPGPVRDLPAYRAFLEGIGYIVPAPASVKASTANVDTEIAEQAGPQ
LVVPLSNQRYALNAANARWGSLYDALYGTDAIPDTEGAERQKTFNPVRGAAVIAYARKFL
DEAAPLANGSHADATRYSVQEGKLVVALKNGASELKTPAQFIGYQGDASAPSAVLLKHNG
LHVEIQIDANDPIGKTDAAQVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMN
GDLTEEVTKNGKTFTRRLNADREYIGADGKTPVTLHGRSLLFIRNVGHLMTNPAVLTKDG
AEIPEGILDAVITTLCALHDRKNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLK
LPRNTIKMGIMDEERRTSVNLLACIAEAAERVAFINTGFLDRTGDEMHSAMEAGPMMRKG
DMKSSTWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIGHPKAGANTAW
VPSPTAATLHALHYHQVDVQAVQQELERTEYAKVRDELLDGLLTIPVVETAKWSADEIRA
ELDNNAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTRE
QVEETFRRMAKVVDQQNAADPFYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKF
RLAVKKG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtcgatgactcagatgaacccgcgcggcggactgcaggtcgccgccaatctc
gaccagttcgttgaaacggaagccctgcccggcaccggaatcgacagcgccgcattctgg
tcgggtttcgacgccctcgtgcacgagctggcgcccaaaaaccgtgcgctcctcgccgag
cgcgaccgcctgcaaacggagctggacacctggcatcgcgccaatccggggccggtgcgc
gacctgcccgcctatcgtgcgtttcttgagggcatcggctatatcgtgcccgcgcccgcc
agcgtgaaggcgagcaccgcgaacgtcgacacggaaatcgccgaacaggccggcccgcaa
ctggtggtgccgctgtcgaatcagcgctatgcgctcaatgcggcaaacgcgcggtggggc
agcctctacgacgcgctgtacggcaccgacgcgattcccgacacggagggcgccgaacgg
cagaagaccttcaacccggtgcgcggcgccgccgttatcgcctatgcccgcaagttcctc
gatgaggccgcgccgctcgcgaacggctcgcatgcggatgcgacgcgctacagcgtgcag
gagggcaagctcgtcgtcgcgttgaaaaacggcgcgagcgaactgaagacgcccgcgcag
ttcatcggctatcagggcgatgcgagcgcgccctcggcagtgctgctgaagcacaacggc
ctgcacgtcgagatccagatcgatgcgaacgacccgatcggcaagaccgacgccgcgcag
gtgaaggacgtggtggtggaggcggcggtgagcaccatcatcgactgcgaggactccgtt
gcggccgtggatgcagacgacaaggtccagctctatcgcaactggctcgggctgatgaac
ggcgatctgaccgaagaggtcacgaaaaacggcaagaccttcacgcgccgtctgaacgcg
gatcgcgaatacatcggcgcggacggcaagacgcccgtcacgctgcatgggcgctcgctc
cttttcatccgcaacgtcggccacctgatgaccaatccggccgtgctgacgaaagacggc
gcggagattcccgaagggattctcgatgcagtgatcaccacgttgtgcgcgctgcacgat
cgcaagaacaagctcaattcgcgcaccggctccatctatatcgtgaagccgaaaatgcac
ggcccggccgaagtggcattcgcgagcgagctgtttgcgcgcgtcgaagacctgctcaag
ctgccgcgcaacaccatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaac
ctgctcgcgtgtatcgccgaggccgcggagcgcgtcgcgttcatcaacacgggctttctc
gatcgcaccggcgacgagatgcatagcgcgatggaagctggcccgatgatgcgcaagggc
gacatgaagtcgagcacgtggatcgcggcctatgagcgcagcaatgtgctcgtcggcttg
cacgccgggctgcgcggccgctcgcagatcggcaagggcatgtgggccatgcccgatctg
atgcacgccatgctcgaacagaaaatcggccatccgaaggccggcgcgaataccgcgtgg
gtgccctcgcccaccgccgcgacgctgcatgcgctgcactatcaccaggtcgacgtgcag
gcggttcagcaggaactggagcgcaccgagtacgcgaaggtgcgcgacgagctgctggac
ggtctgctgaccattcccgtcgtcgaaaccgcgaagtggagcgccgacgaaattcgcgcc
gagctcgacaacaacgcgcaaggcattctcggctacgtggtgcgctggatcgaccagggc
gtgggctgctcgaaggtgccggatattcacgacgtcggcctgatggaagaccgcgcgacg
ctgcgtatctcgagccagcacatcgccaactggctgtatcacggcgtggtgacgcgcgag
caggtcgaagagaccttcaggcgcatggcgaaagtggtcgatcagcagaatgccgccgat
ccgttctacaagccgatggcgccgggtttcgacaccatcgcgttcaaggccgcgcaggcg
ctggtgttcgaaggacgccagcagccgagcggctacacggaaccgttgctgcacaagttc
cgtctcgcggtgaagaaaggctga

DBGET integrated database retrieval system