KEGG   Paraburkholderia phenoliruptrix: BUPH_02156Help
Entry
BUPH_02156        CDS       T02300                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00620  Pyruvate metabolism
bpx00630  Glyoxylate and dicarboxylate metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01200  Carbon metabolism
Module
bpx_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_02156
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_02156
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BUPH_02156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFT85728
UniProt: K0DPB3
Position
1:1899752..1901935
Genome map
AA seq 727 aa AA seqDB search
MEQSMTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAE
RDRLQTELDTWHRANPGPVRDLPAYRAFLEGIGYIVPAPASVKASTANVDTEIAEQAGPQ
LVVPLSNQRYALNAANARWGSLYDALYGTDAIPDTEGAERQKTFNPVRGAAVIAYARKFL
DEAAPLANGSHADATRYSVQEGKLVVALKNGASELKTPAQFIGYQGDASAPSAVLLKHNG
LHVEIQIDANDPIGKTDAAQVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMN
GDLTEEVTKNGKTFTRRLNADREYIGADGKTPVTLHGRSLLFIRNVGHLMTNPAVLTKDG
AEIPEGILDAVITTLCALHDRKNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLK
LPRNTIKMGIMDEERRTSVNLLACIAEAAERVAFINTGFLDRTGDEMHSAMEAGPMMRKG
DMKSSTWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIGHPKAGANTAW
VPSPTAATLHALHYHQVDVQAVQQELERTEYAKVRDELLDGLLTIPVVETAKWSADEIRA
ELDNNAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTRE
QVEETFRRMAKVVDQQNAADPFYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKF
RLAVKKG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtcgatgactcagatgaacccgcgcggcggactgcaggtcgccgccaatctc
gaccagttcgttgaaacggaagccctgcccggcaccggaatcgacagcgccgcattctgg
tcgggtttcgacgccctcgtgcacgagctggcgcccaaaaaccgtgcgctcctcgccgag
cgcgaccgcctgcaaacggagctggacacctggcatcgcgccaatccggggccggtgcgc
gacctgcccgcctatcgtgcgtttcttgagggcatcggctatatcgtgcccgcgcccgcc
agcgtgaaggcgagcaccgcgaacgtcgacacggaaatcgccgaacaggccggcccgcaa
ctggtggtgccgctgtcgaatcagcgctatgcgctcaatgcggcaaacgcgcggtggggc
agcctctacgacgcgctgtacggcaccgacgcgattcccgacacggagggcgccgaacgg
cagaagaccttcaacccggtgcgcggcgccgccgttatcgcctatgcccgcaagttcctc
gatgaggccgcgccgctcgcgaacggctcgcatgcggatgcgacgcgctacagcgtgcag
gagggcaagctcgtcgtcgcgttgaaaaacggcgcgagcgaactgaagacgcccgcgcag
ttcatcggctatcagggcgatgcgagcgcgccctcggcagtgctgctgaagcacaacggc
ctgcacgtcgagatccagatcgatgcgaacgacccgatcggcaagaccgacgccgcgcag
gtgaaggacgtggtggtggaggcggcggtgagcaccatcatcgactgcgaggactccgtt
gcggccgtggatgcagacgacaaggtccagctctatcgcaactggctcgggctgatgaac
ggcgatctgaccgaagaggtcacgaaaaacggcaagaccttcacgcgccgtctgaacgcg
gatcgcgaatacatcggcgcggacggcaagacgcccgtcacgctgcatgggcgctcgctc
cttttcatccgcaacgtcggccacctgatgaccaatccggccgtgctgacgaaagacggc
gcggagattcccgaagggattctcgatgcagtgatcaccacgttgtgcgcgctgcacgat
cgcaagaacaagctcaattcgcgcaccggctccatctatatcgtgaagccgaaaatgcac
ggcccggccgaagtggcattcgcgagcgagctgtttgcgcgcgtcgaagacctgctcaag
ctgccgcgcaacaccatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaac
ctgctcgcgtgtatcgccgaggccgcggagcgcgtcgcgttcatcaacacgggctttctc
gatcgcaccggcgacgagatgcatagcgcgatggaagctggcccgatgatgcgcaagggc
gacatgaagtcgagcacgtggatcgcggcctatgagcgcagcaatgtgctcgtcggcttg
cacgccgggctgcgcggccgctcgcagatcggcaagggcatgtgggccatgcccgatctg
atgcacgccatgctcgaacagaaaatcggccatccgaaggccggcgcgaataccgcgtgg
gtgccctcgcccaccgccgcgacgctgcatgcgctgcactatcaccaggtcgacgtgcag
gcggttcagcaggaactggagcgcaccgagtacgcgaaggtgcgcgacgagctgctggac
ggtctgctgaccattcccgtcgtcgaaaccgcgaagtggagcgccgacgaaattcgcgcc
gagctcgacaacaacgcgcaaggcattctcggctacgtggtgcgctggatcgaccagggc
gtgggctgctcgaaggtgccggatattcacgacgtcggcctgatggaagaccgcgcgacg
ctgcgtatctcgagccagcacatcgccaactggctgtatcacggcgtggtgacgcgcgag
caggtcgaagagaccttcaggcgcatggcgaaagtggtcgatcagcagaatgccgccgat
ccgttctacaagccgatggcgccgggtttcgacaccatcgcgttcaaggccgcgcaggcg
ctggtgttcgaaggacgccagcagccgagcggctacacggaaccgttgctgcacaagttc
cgtctcgcggtgaagaaaggctga

DBGET integrated database retrieval system