KEGG   Burkholderia phenoliruptrix: BUPH_02156Help
Entry
BUPH_02156        CDS       T02300                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_02156
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_02156
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_02156
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BUPH_02156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1899752..1901935
Genome map
AA seq 727 aa AA seqDB search
MEQSMTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAE
RDRLQTELDTWHRANPGPVRDLPAYRAFLEGIGYIVPAPASVKASTANVDTEIAEQAGPQ
LVVPLSNQRYALNAANARWGSLYDALYGTDAIPDTEGAERQKTFNPVRGAAVIAYARKFL
DEAAPLANGSHADATRYSVQEGKLVVALKNGASELKTPAQFIGYQGDASAPSAVLLKHNG
LHVEIQIDANDPIGKTDAAQVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMN
GDLTEEVTKNGKTFTRRLNADREYIGADGKTPVTLHGRSLLFIRNVGHLMTNPAVLTKDG
AEIPEGILDAVITTLCALHDRKNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLK
LPRNTIKMGIMDEERRTSVNLLACIAEAAERVAFINTGFLDRTGDEMHSAMEAGPMMRKG
DMKSSTWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIGHPKAGANTAW
VPSPTAATLHALHYHQVDVQAVQQELERTEYAKVRDELLDGLLTIPVVETAKWSADEIRA
ELDNNAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTRE
QVEETFRRMAKVVDQQNAADPFYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKF
RLAVKKG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtcgatgactcagatgaacccgcgcggcggactgcaggtcgccgccaatctc
gaccagttcgttgaaacggaagccctgcccggcaccggaatcgacagcgccgcattctgg
tcgggtttcgacgccctcgtgcacgagctggcgcccaaaaaccgtgcgctcctcgccgag
cgcgaccgcctgcaaacggagctggacacctggcatcgcgccaatccggggccggtgcgc
gacctgcccgcctatcgtgcgtttcttgagggcatcggctatatcgtgcccgcgcccgcc
agcgtgaaggcgagcaccgcgaacgtcgacacggaaatcgccgaacaggccggcccgcaa
ctggtggtgccgctgtcgaatcagcgctatgcgctcaatgcggcaaacgcgcggtggggc
agcctctacgacgcgctgtacggcaccgacgcgattcccgacacggagggcgccgaacgg
cagaagaccttcaacccggtgcgcggcgccgccgttatcgcctatgcccgcaagttcctc
gatgaggccgcgccgctcgcgaacggctcgcatgcggatgcgacgcgctacagcgtgcag
gagggcaagctcgtcgtcgcgttgaaaaacggcgcgagcgaactgaagacgcccgcgcag
ttcatcggctatcagggcgatgcgagcgcgccctcggcagtgctgctgaagcacaacggc
ctgcacgtcgagatccagatcgatgcgaacgacccgatcggcaagaccgacgccgcgcag
gtgaaggacgtggtggtggaggcggcggtgagcaccatcatcgactgcgaggactccgtt
gcggccgtggatgcagacgacaaggtccagctctatcgcaactggctcgggctgatgaac
ggcgatctgaccgaagaggtcacgaaaaacggcaagaccttcacgcgccgtctgaacgcg
gatcgcgaatacatcggcgcggacggcaagacgcccgtcacgctgcatgggcgctcgctc
cttttcatccgcaacgtcggccacctgatgaccaatccggccgtgctgacgaaagacggc
gcggagattcccgaagggattctcgatgcagtgatcaccacgttgtgcgcgctgcacgat
cgcaagaacaagctcaattcgcgcaccggctccatctatatcgtgaagccgaaaatgcac
ggcccggccgaagtggcattcgcgagcgagctgtttgcgcgcgtcgaagacctgctcaag
ctgccgcgcaacaccatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaac
ctgctcgcgtgtatcgccgaggccgcggagcgcgtcgcgttcatcaacacgggctttctc
gatcgcaccggcgacgagatgcatagcgcgatggaagctggcccgatgatgcgcaagggc
gacatgaagtcgagcacgtggatcgcggcctatgagcgcagcaatgtgctcgtcggcttg
cacgccgggctgcgcggccgctcgcagatcggcaagggcatgtgggccatgcccgatctg
atgcacgccatgctcgaacagaaaatcggccatccgaaggccggcgcgaataccgcgtgg
gtgccctcgcccaccgccgcgacgctgcatgcgctgcactatcaccaggtcgacgtgcag
gcggttcagcaggaactggagcgcaccgagtacgcgaaggtgcgcgacgagctgctggac
ggtctgctgaccattcccgtcgtcgaaaccgcgaagtggagcgccgacgaaattcgcgcc
gagctcgacaacaacgcgcaaggcattctcggctacgtggtgcgctggatcgaccagggc
gtgggctgctcgaaggtgccggatattcacgacgtcggcctgatggaagaccgcgcgacg
ctgcgtatctcgagccagcacatcgccaactggctgtatcacggcgtggtgacgcgcgag
caggtcgaagagaccttcaggcgcatggcgaaagtggtcgatcagcagaatgccgccgat
ccgttctacaagccgatggcgccgggtttcgacaccatcgcgttcaaggccgcgcaggcg
ctggtgttcgaaggacgccagcagccgagcggctacacggaaccgttgctgcacaagttc
cgtctcgcggtgaagaaaggctga

DBGET integrated database retrieval system