KEGG   Burkholderia phenoliruptrix: BUPH_02301Help
Entry
BUPH_02301        CDS       T02300                                 

Definition
(RefSeq) threoninee synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUPH_02301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUPH_02301
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BUPH_02301
Enzymes [BR:bpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BUPH_02301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2077092..2078543)
Genome map
AA seq 483 aa AA seqDB search
MNYLSTRGAGAGERHTFSDILLGGLAKDGGLYLPADYPRVSADELARWRTLPYADLAFEI
LSKFSDDIPAEDLRALTRKTYTAATYCNVRDDESAAQITPLKTLGVENGAPLSLLELSNG
PTLAFKDMAMQLIGNLFEYALAKHGETLNILGATSGDTGSAAEYAMRGKQGIRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAKYKIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIERLVVATNENDV
LDEFFRTGIYRVRKAAETYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVKEFGFVSGRSSHDDRVEAIRDVFQRYDTMIDTHTADGLKVAREHLQP
GIPMIVLETAQPIKFGETIREALLREPERPAAFAGLESLPQRFEVVPADAQRVKDFIAAN
TGV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactatctctccacgcgcggcgccggagccggcgagcgccacaccttctcggacatt
ctgctcggcggtctcgcgaaagacggcggcctgtatctgccggccgactacccgcgtgtc
agcgccgacgaactcgcgcgctggcgcacgctgccgtacgccgacctcgccttcgagatc
ctgtcgaaattcagcgacgacattccggctgaagatttgcgcgccctcacgcgcaagacc
tacacggcagccacgtactgcaacgtgcgcgacgacgaaagcgccgcgcagatcacgccg
ctcaagacgctcggcgtggagaacggcgcgccgctgtcgctgctcgaactgtcgaacggt
ccgacgctcgccttcaaggacatggcgatgcagctgatcggcaacctgttcgagtacgcg
ctcgccaaacacggcgaaacgctgaacattctcggcgcgacctccggcgacaccggcagc
gccgccgaatacgcgatgcgcggcaagcagggcattcgcgtgttcatgctgtcgccgcac
aagaaaatgagcgcgttccagaccgcgcagatgtacagcctgcaggacccgaacattttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtcaaagccgtctcgaac
gatcacgcgttcaaggcgaagtacaagatcggcacggtcaattcgatcaactgggcgcgt
gtggtcgcgcaggtcgtctattacttcaagggctacttcgctgccacgaagagcaacgac
gagcgcgtgtcgttcactgtgccgtcgggcaatttcggcaatgtgtgcgcgggtcacatc
gcgcgcatgatgggactgccgatcgaaaggctcgtggtcgccaccaacgaaaacgacgtg
ctcgacgagttcttccgcaccggcatctaccgcgtacgcaaggcggccgagacgtatcac
accagcagcccgagcatggatatttcgaaggcgtcgaacttcgagcgcttcgtgttcgat
ctgctcggccgcgacccggcgcgcgtgctgcaactgttccgcgatgtcgaggaaaaaggc
ggattcgacctcgcggcgagcggcgactttgctcgcgtgaaggaattcggcttcgtgtcg
ggccgcagcagccacgacgatcgcgtcgaagcgatccgcgacgtgttccagcgctacgac
accatgatcgacacgcataccgccgacggcctgaaggtcgcgcgcgaacatctgcagccg
ggcattccgatgatcgtgctggaaacggcgcagcccatcaagttcggcgagacgattcgg
gaggcgctgctgcgcgaaccggagcgcccggcggcgttcgccggactggagtcgctgccg
cagcgcttcgaagtcgtgcccgcggacgctcagcgcgtgaaagacttcatcgcggccaac
acgggcgtctga

DBGET integrated database retrieval system