KEGG   Burkholderia phenoliruptrix: BUPH_02301Help
Entry
BUPH_02301        CDS       T02300                                 

Definition
threoninee synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUPH_02301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUPH_02301
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BUPH_02301
Enzymes [BR:bpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BUPH_02301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2077092..2078543)
Genome map
AA seq 483 aa AA seqDB search
MNYLSTRGAGAGERHTFSDILLGGLAKDGGLYLPADYPRVSADELARWRTLPYADLAFEI
LSKFSDDIPAEDLRALTRKTYTAATYCNVRDDESAAQITPLKTLGVENGAPLSLLELSNG
PTLAFKDMAMQLIGNLFEYALAKHGETLNILGATSGDTGSAAEYAMRGKQGIRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAKYKIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIERLVVATNENDV
LDEFFRTGIYRVRKAAETYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVKEFGFVSGRSSHDDRVEAIRDVFQRYDTMIDTHTADGLKVAREHLQP
GIPMIVLETAQPIKFGETIREALLREPERPAAFAGLESLPQRFEVVPADAQRVKDFIAAN
TGV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactatctctccacgcgcggcgccggagccggcgagcgccacaccttctcggacatt
ctgctcggcggtctcgcgaaagacggcggcctgtatctgccggccgactacccgcgtgtc
agcgccgacgaactcgcgcgctggcgcacgctgccgtacgccgacctcgccttcgagatc
ctgtcgaaattcagcgacgacattccggctgaagatttgcgcgccctcacgcgcaagacc
tacacggcagccacgtactgcaacgtgcgcgacgacgaaagcgccgcgcagatcacgccg
ctcaagacgctcggcgtggagaacggcgcgccgctgtcgctgctcgaactgtcgaacggt
ccgacgctcgccttcaaggacatggcgatgcagctgatcggcaacctgttcgagtacgcg
ctcgccaaacacggcgaaacgctgaacattctcggcgcgacctccggcgacaccggcagc
gccgccgaatacgcgatgcgcggcaagcagggcattcgcgtgttcatgctgtcgccgcac
aagaaaatgagcgcgttccagaccgcgcagatgtacagcctgcaggacccgaacattttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtcaaagccgtctcgaac
gatcacgcgttcaaggcgaagtacaagatcggcacggtcaattcgatcaactgggcgcgt
gtggtcgcgcaggtcgtctattacttcaagggctacttcgctgccacgaagagcaacgac
gagcgcgtgtcgttcactgtgccgtcgggcaatttcggcaatgtgtgcgcgggtcacatc
gcgcgcatgatgggactgccgatcgaaaggctcgtggtcgccaccaacgaaaacgacgtg
ctcgacgagttcttccgcaccggcatctaccgcgtacgcaaggcggccgagacgtatcac
accagcagcccgagcatggatatttcgaaggcgtcgaacttcgagcgcttcgtgttcgat
ctgctcggccgcgacccggcgcgcgtgctgcaactgttccgcgatgtcgaggaaaaaggc
ggattcgacctcgcggcgagcggcgactttgctcgcgtgaaggaattcggcttcgtgtcg
ggccgcagcagccacgacgatcgcgtcgaagcgatccgcgacgtgttccagcgctacgac
accatgatcgacacgcataccgccgacggcctgaaggtcgcgcgcgaacatctgcagccg
ggcattccgatgatcgtgctggaaacggcgcagcccatcaagttcggcgagacgattcgg
gaggcgctgctgcgcgaaccggagcgcccggcggcgttcgccggactggagtcgctgccg
cagcgcttcgaagtcgtgcccgcggacgctcagcgcgtgaaagacttcatcgcggccaac
acgggcgtctga

DBGET integrated database retrieval system