KEGG   Burkholderia phenoliruptrix: BUPH_02303Help
Entry
BUPH_02303        CDS       T02300                                 

Definition
alanine-synthesizing transaminase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BUPH_02303
   01230 Biosynthesis of amino acids
    BUPH_02303
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BUPH_02303
   00290 Valine, leucine and isoleucine biosynthesis
    BUPH_02303
Enzymes [BR:bpx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BUPH_02303
    2.6.1.66  valine---pyruvate transaminase
     BUPH_02303
Amino acid related enzymes [BR:bpx01007]
 Aminotransferase (transaminase)
  Class I
   BUPH_02303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2079979..2081217)
Genome map
AA seq 412 aa AA seqDB search
MKPILKSNKLLNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFEAPDEIIQDMIL
NLPGSSGYSDSKGVFAARKAIMHYTQQKGVHGVELDDIYIGNGASELIVMALQGLLNDGD
EVLLPAPDYPLWTAGVSLAGGTPVHYICDESNRWMPDLDDIRAKITPNTRALVVINPNNP
TGALYSDELLLGLIEIARQHGLVIFADEVYDKIVYDGKKHTSMAALSEDVLTVTFNSLSK
SYRSCGYRAGWMFISGLTGENRRSAKDYFEGLGILASMRLCPNVPGQYAIQTALGGYQSI
NDLIVPSGRLYKQRELAYDMLTAIPGVSCVKPEAALYMFPRLDPKIYPIDNDQQFILDLL
LEERVLLVQGTGFNWKTPDHFRVVFLPNVDDLADSINRIARFLDGYRKRHTA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattctcaagtccaacaagttattgaatgtctgctacgacattcgcgggccc
gtcctcgaacatgcgaaacggctcgaagaagaaggccaccgcatcatcaagctgaatatc
ggcaacctggccccgttcggttttgaagcgccggacgaaatcatccaggacatgatcctg
aacctgccgggttcgtcgggctactcggactcgaagggcgtgttcgccgcgcgcaaggcg
atcatgcactacacgcagcaaaagggcgtacatggcgtcgagctggacgacatctacatc
ggcaacggcgcgtcggagctgatcgtcatggcgctccaggggctcctgaacgacggcgac
gaagtgctgctgcccgcgccggactatccgctgtggacggcgggcgtgagcctcgcgggc
ggcacgcctgtgcattacatctgcgacgagtccaaccgctggatgcccgacctcgacgac
atccgcgccaaaatcacgccgaatacgcgcgcgctcgtggtcatcaatccgaacaatccg
acgggcgcgctgtattccgacgaactgctgctcggcctcatcgaaatcgcgcgccagcac
ggcctcgtgattttcgccgacgaggtgtacgacaagatcgtctacgacggcaagaagcac
acgtcgatggccgcgctgtccgaagacgtgctgaccgtcacgttcaacagcctgtcgaag
agctaccgctcgtgcggctaccgcgccggctggatgttcatctcgggcctgacgggcgaa
aaccgccgcagcgcgaaagattatttcgaaggcctcggcattctcgcctccatgcgcctg
tgtccgaacgtgcccggccagtacgcgatccagaccgcgctcggcggctatcagagcatc
aacgacctgatcgtgccgagcgggcgcctctacaagcagcgcgagctcgcgtacgacatg
ctgaccgccatccccggcgtgagctgcgtgaagccggaggcggcgctctacatgttcccg
cgcctcgacccgaagatttatcccatcgacaacgatcagcagttcattctcgacctgctc
ctcgaagagcgtgtgctgctcgtgcagggcaccggcttcaactggaagacgccggatcac
ttccgcgtcgtgttcctgccgaacgtggacgatctggccgattcgatcaaccggatcgcg
cgcttcctcgacggttatcgcaaacgtcacacggcgtag

DBGET integrated database retrieval system