KEGG   Burkholderia phenoliruptrix: BUPH_02540Help
Entry
BUPH_02540        CDS       T02300                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BUPH_02540
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BUPH_02540
Exosome [BR:bpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUPH_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2358827..2360242)
Genome map
AA seq 471 aa AA seqDB search
MRIAAIDQGTTSTRVLVADSNGGADIVHSVRHRQHHPQPGWVEHSPEELLSNLNACIEAA
GTIDAIGIDNQGESCLAWDAESGEALSPVIVWQDNRTAELLKNLRQEGAEELTLSRAGLP
LDPYFSASKLAWLLQHNDRVKAARRAGTLRLGTTDAYFLDCLTGHFATDTTTASRTSLMN
LEKGEWDEDLCRLFGVPVECLPEIRPTVGEFGSVGTIPVTASIVDQQAALYGHGCRKTGD
AKVTFGTGAFALALTGNQIVRAPEQGLLPTVAWRIGNEITYALDGGVYDASSAVEWAGRL
GLFADLSEISTFETPPAIMQGLAFVPALSGLACPHWDRGAGALWVGMCASTTKSDLCQAL
LEGIALCTSEVIAAMMDRVNVTDRLSIDGGLGRNVYFVQFLADVLERTIVTQRFHELTAF
GCAALASMGLGSALPEYRNASTAFHPRQDKATVGEWKVRFAEAVTRSKGWR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgcagcaatagatcagggcacgaccagcactcgtgtgttggtggccgacagc
aatggaggcgcggatattgttcactccgtgcgccatcgacagcatcatccgcaaccaggc
tgggtcgaacattcgcctgaagagctgctgtcgaacctgaacgcgtgcattgaagcggcc
ggcacgattgatgccatcgggatcgacaatcaaggggaaagctgtctggcctgggacgct
gaatcgggcgaggcactgtcgccggtgattgtgtggcaggacaaccggacggcggagttg
ctgaagaatctccgacaagagggcgcggaggaactgacgctctcccgtgctggtctgccg
ctcgacccctacttttctgcgtcgaaactcgcctggttgctgcagcataacgatcgagta
aaggccgcgcggcgggctggcacgcttcgccttggtacgacggatgcgtatttccttgac
tgtctcacagggcacttcgcaaccgataccacgacagcatcccgtacgtctctgatgaat
ctcgagaaaggcgaatgggatgaggatctgtgtcgcctgttcggtgtaccggtcgaatgc
cttccggagattcggccgaccgtcggagagtttggaagcgtcgggacgattcccgtgaca
gcttcaatcgtcgaccagcaagcagcgttgtatgggcacggctgccgtaaaacgggcgac
gccaaagttacttttggtaccggggccttcgcactggccttgaccggaaaccagatcgtc
cgcgcgccagagcaggggctactcccgactgtcgcgtggcggatcggaaacgaaatcact
tatgcgctcgatggtggcgtctacgacgcgagctcagcagtggagtgggcaggacgactg
ggtttgtttgccgacctttccgagatttcaacgtttgagacgccgccggccattatgcaa
ggacttgcgtttgtgccggcgctctccggcttggcgtgtccgcactgggatcgcggagct
ggcgccctatgggttggtatgtgcgcatcgacgacaaagagtgatctttgtcaggctctc
ctcgaaggtatcgcgctctgcacgtcggaggtgatcgctgcgatgatggaccgcgtgaac
gttactgaccgtctgtctatcgacggggggctggggcgaaatgtctatttcgttcagttt
cttgccgacgttctcgagcgaacgattgtgacgcagcgtttccatgaactgaccgcgttc
ggttgcgcagcgcttgcctcgatgggccttggctcggcgttacctgagtacaggaatgcg
tcgacagcatttcacccgcgccaggacaaggcgacagttggcgaatggaaggtccgtttt
gccgaggcggtgactagatcaaaaggctggagataa

DBGET integrated database retrieval system