KEGG   Burkholderia phenoliruptrix: BUPH_02767Help
Entry
BUPH_02767        CDS       T02300                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_02767
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_02767
Enzymes [BR:bpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BUPH_02767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2652022..2653329
Genome map
AA seq 435 aa AA seqDB search
MTTREEQARQLQQQWETDPRWKGVKRSYTAEDVIRLRGSLQVEHTLAKRGAEKLWHSVNT
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVK
RINNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTRENIAKLTAARLAADVSGVPTVLLARTDAEAADLIT
SDVDENDKPFLTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKFA
DAIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSM
FNLAHGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTAL
HGSTEDEQFFDKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgcgaagaacaagcccgccaacttcaacagcaatgggaaaccgatccgcgc
tggaaaggcgtcaagcgcagctacacggcagaagacgtgatccgtctgcgcggctcgctg
caggtcgagcacacgctcgcgaagcgcggcgccgaaaaactctggcacagcgtgaacacc
gagccgttcgtcaactcgctcggcgcgctcaccggtaaccaggcgatgcaacaggtcaag
gccgggctgaaggcgatctacctgtcgggctggcaggtggcgggcgacgcgaatgtggcg
ggcgaaatgtatcccgaccagtcgttgtacccggcgaattcggtgccgctcgtcgtcaag
cgcatcaacaatacgctcacgcgcgccgaccagatccagtggtcggaaggcaagaatccg
ggcgacgaaggctatatcgactactttgcaccgatcgtcgccgatgcggaagccggtttc
ggcggcgtgctgaacgcgttcgaactgatgaaggccatgatcgaagccggcgccgcaggc
gtgcacttcgaagaccagctcgcctcggtgaagaagtgcggccacatgggcggcaaggtg
ctcgtgccgacgcgcgaaaacattgccaagctgacggccgcgcgtctcgccgccgacgtc
tccggcgtgccgaccgtgctgcttgcccgcaccgatgccgaagccgccgacctgatcacc
tcggacgtggacgaaaacgacaagccgttcctgaccggcgagcgcaccgtcgaaggcttc
taccgcacgaagccgggtctcgaacaggcgatttcgcgcggcctcgcctatgcgccgtac
gccgacatgatctggtgcgaaaccggcaagccggacctcgagtttgcgaagaagttcgcc
gacgcgatccacaaggagtacccggatcaactgctgtcgtacaactgctcgccgtcgttc
aactggaagaagaatctcgacgacgcgaccatcgccaagttccagcgcgaactcggcgcg
atgggctacaagttccagttcatcacgctcgccggcttccacgcgctgaactactcgatg
ttcaacctcgcgcacggctacgcgcgcaatcagatgaccgcgttcgtcgaaatgcagcag
gccgaattcgcggcggcggaaaagggcttcaccgccgtcaagcaccagcgcgaagtgggc
acgggctatttcgacgcggtcacgcagacggtggagcgcgaagcgtcgacgaccgcgctg
cacggctcgacggaagacgaacagttcttcgacaagaaagtcgcgtaa

DBGET integrated database retrieval system