KEGG   Burkholderia phenoliruptrix: BUPH_02771Help
Entry
BUPH_02771        CDS       T02300                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bpx01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpx00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bpx00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2656173..2657810
Genome map
AA seq 545 aa AA seqDB search
MHFRNLTDQGENMANSQSSLSLPQGVAITGEIKPGYEAILTREALELVAALHRTFEPRRQ
QLLQARAERTKRLDAGERPDFLAETKSVRESDWTIAPLPHDLQRRRVEITGPVERKMIIN
ALNSGADSYMTDFEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKHYKLNDTIATLIVR
PRGWHLDEKHVSVDGKRVSGGIFDFALFMVHNAKELIARGSGPYFYLPKMESHLEARLWN
DIFVAAQEAVGVPRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKK
FKADRDFCLADRSQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKA
MAGVRSDKARDAGDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLL
DFRPETPITEAGLRNNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSP
KGTLDDGRKVTAELVRELAVQELDKVKQAVGGDTAPYERAAQIFEQMSTSAQFTDFLTLP
LYEEI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttgcattttcgcaatctgaccgaccaaggagaaaacatggcgaattcgcagtcatcgctg
tcgctgccgcagggcgtggcaatcaccggcgaaatcaaaccgggttatgaagcaattctg
acccgcgaggcgctcgaactcgtcgccgcgctgcatcgcaccttcgagccgcgccgtcag
cagctgctgcaggcgcgcgcggaacgcacgaagcgtctcgacgcgggcgagcgccccgac
ttcctcgccgagacgaagagcgtgcgcgagagcgactggaccatcgcaccgctgccgcac
gacctgcaacgccgccgcgtcgaaatcacggggccggtagaacgcaagatgatcatcaac
gcgctgaactccggcgcggattcgtacatgaccgacttcgaggattcgaatgcgccgagc
tgggacaaccagatcaccggccatatcaacctgaaggacgccgtgcgccgcacgatttcg
ctggagcagaacggcaagcactacaagctgaacgacaccatcgccacgctgatcgtgcgc
ccgcgcggctggcatctcgacgagaagcacgtgagcgtggacggcaagcgcgtgtcgggc
ggcatcttcgacttcgcgctcttcatggtgcataacgcgaaggaactgatcgcgcgcggc
tccggcccctacttctatctgccgaagatggaaagccacctcgaggcgcgtctgtggaac
gacatcttcgtcgccgcgcaggaagcggtcggcgtgccgcgcggcacgattcgcgcgacg
gtgctgatcgaaaccattctcgccgcgttcgaaatggacgaaatcctgtacgagctgcgt
gaacacagctcgggcctgaacgcgggccgctgggactacatcttctcggcgatcaagaag
ttcaaggccgaccgcgacttctgcctcgcagaccgctcgcagatcacgatgacctcgccc
ttcatgcgcgcctatgcgctgttgctgctgaagacttgccaccgccgcaatgcgccggct
atcggcggcatgagcgcgctgattccgatcaagaacgacccggccgcgaacgacaaggcg
atggccggcgtgcgctcggacaaggcgcgcgatgcgggcgacggctacgacggcggctgg
gtcgcgcacccggggctcgtgcctatcgcaatggaagaattcgtcaaggtgctgggggac
aagccgaaccagatcggcaagcaacgcgacgacgtgctcgtcaccgcgacggatctgctc
gacttccgcccggagacgccgattaccgaagccggtttgcgcaacaacatcaacgtcggc
attcactacctgggttcgtggctcgcgggcaatggctgcgtgccgatccacaacctgatg
gaagacgccgcgaccgccgagatttcgcgctcgcaggtgtggcaatggatccgctcgccg
aagggcacgctcgacgacggccgcaaggtgaccgctgaactggtgcgcgagctggccgtg
caggaactcgacaaggtgaagcaggcggtgggcggcgataccgcgccgtacgagcgcgct
gcgcaaatcttcgagcagatgtcgacgtccgcgcagttcactgacttcctgacgctgccg
ctctacgaagaaatttga

DBGET integrated database retrieval system