KEGG   Burkholderia phenoliruptrix: BUPH_02771Help
Entry
BUPH_02771        CDS       T02300                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_02771
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_02771
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_02771
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BUPH_02771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2656173..2657810
Genome map
AA seq 545 aa AA seqDB search
MHFRNLTDQGENMANSQSSLSLPQGVAITGEIKPGYEAILTREALELVAALHRTFEPRRQ
QLLQARAERTKRLDAGERPDFLAETKSVRESDWTIAPLPHDLQRRRVEITGPVERKMIIN
ALNSGADSYMTDFEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKHYKLNDTIATLIVR
PRGWHLDEKHVSVDGKRVSGGIFDFALFMVHNAKELIARGSGPYFYLPKMESHLEARLWN
DIFVAAQEAVGVPRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKK
FKADRDFCLADRSQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKA
MAGVRSDKARDAGDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLL
DFRPETPITEAGLRNNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSP
KGTLDDGRKVTAELVRELAVQELDKVKQAVGGDTAPYERAAQIFEQMSTSAQFTDFLTLP
LYEEI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttgcattttcgcaatctgaccgaccaaggagaaaacatggcgaattcgcagtcatcgctg
tcgctgccgcagggcgtggcaatcaccggcgaaatcaaaccgggttatgaagcaattctg
acccgcgaggcgctcgaactcgtcgccgcgctgcatcgcaccttcgagccgcgccgtcag
cagctgctgcaggcgcgcgcggaacgcacgaagcgtctcgacgcgggcgagcgccccgac
ttcctcgccgagacgaagagcgtgcgcgagagcgactggaccatcgcaccgctgccgcac
gacctgcaacgccgccgcgtcgaaatcacggggccggtagaacgcaagatgatcatcaac
gcgctgaactccggcgcggattcgtacatgaccgacttcgaggattcgaatgcgccgagc
tgggacaaccagatcaccggccatatcaacctgaaggacgccgtgcgccgcacgatttcg
ctggagcagaacggcaagcactacaagctgaacgacaccatcgccacgctgatcgtgcgc
ccgcgcggctggcatctcgacgagaagcacgtgagcgtggacggcaagcgcgtgtcgggc
ggcatcttcgacttcgcgctcttcatggtgcataacgcgaaggaactgatcgcgcgcggc
tccggcccctacttctatctgccgaagatggaaagccacctcgaggcgcgtctgtggaac
gacatcttcgtcgccgcgcaggaagcggtcggcgtgccgcgcggcacgattcgcgcgacg
gtgctgatcgaaaccattctcgccgcgttcgaaatggacgaaatcctgtacgagctgcgt
gaacacagctcgggcctgaacgcgggccgctgggactacatcttctcggcgatcaagaag
ttcaaggccgaccgcgacttctgcctcgcagaccgctcgcagatcacgatgacctcgccc
ttcatgcgcgcctatgcgctgttgctgctgaagacttgccaccgccgcaatgcgccggct
atcggcggcatgagcgcgctgattccgatcaagaacgacccggccgcgaacgacaaggcg
atggccggcgtgcgctcggacaaggcgcgcgatgcgggcgacggctacgacggcggctgg
gtcgcgcacccggggctcgtgcctatcgcaatggaagaattcgtcaaggtgctgggggac
aagccgaaccagatcggcaagcaacgcgacgacgtgctcgtcaccgcgacggatctgctc
gacttccgcccggagacgccgattaccgaagccggtttgcgcaacaacatcaacgtcggc
attcactacctgggttcgtggctcgcgggcaatggctgcgtgccgatccacaacctgatg
gaagacgccgcgaccgccgagatttcgcgctcgcaggtgtggcaatggatccgctcgccg
aagggcacgctcgacgacggccgcaaggtgaccgctgaactggtgcgcgagctggccgtg
caggaactcgacaaggtgaagcaggcggtgggcggcgataccgcgccgtacgagcgcgct
gcgcaaatcttcgagcagatgtcgacgtccgcgcagttcactgacttcctgacgctgccg
ctctacgaagaaatttga

DBGET integrated database retrieval system