KEGG   Paraburkholderia phenoliruptrix: BUPH_03023Help
Entry
BUPH_03023        CDS       T02300                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00040  Pentose and glucuronate interconversions
bpx00052  Galactose metabolism
bpx00500  Starch and sucrose metabolism
bpx00520  Amino sugar and nucleotide sugar metabolism
bpx01100  Metabolic pathways
bpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BUPH_03023
   00052 Galactose metabolism
    BUPH_03023
   00500 Starch and sucrose metabolism
    BUPH_03023
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_03023
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BUPH_03023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFT86598
UniProt: K0DRN1
Position
1:2958376..2959173
Genome map
AA seq 265 aa AA seqDB search
MLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLE
LVRSIKPSHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLYGTPPVMTQMIE
VFDHYHSSVIGVEEIPPQDTKSYGIVDGKEWEDSIIKMSGIVEKPEPSVAPSNLGVVGRY
VLKPRIFDHIRSLKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVE
FALRHPEVAADFEEYLRTRSPVLEG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgatcgtcgacaagccgctgattcaatacgcggtggaagaagccatggcggcc
ggcatcaccgaaatgatcttcgtcacgggccgcagtaaacgggcgatcgaggaccatttc
gacaagtcatacgaaatcgaagccgagctcgaggcacgcggcaaggacaagctgctggaa
ctcgtgcgcagcatcaagccgagtcacgtcgactgtttctacgtacgtcagcccgaagcg
ctcggcctcggccacgcggtgctgtgcgcggagaagctggtgggcgacaatccgttcgcc
gtgattctcgcggacgacctgctgtacggcacgccgcccgtcatgacgcagatgatcgag
gtgttcgaccactatcacagctccgtgattggcgtcgaagaaatcccgccgcaggacacc
aagtcgtacggtattgtcgacggcaaggaatgggaagactcgatcatcaagatgtcgggc
atcgtcgagaagccggagccgagcgtcgcgccgtccaatctcggcgtggtgggccgctat
gtgctgaagccgcgcattttcgaccacatccgttccctcaagccgggcgcgggcggcgaa
ctgcagctcacggacgccatccagtcgctgctcgccgacgaacaggtgctcgcatacaag
tatcacggcacgcgtttcgactgcggcagcaagctcggctatctgaaggcgacggtggaa
ttcgcgctgcgccatccggaagtggctgcggatttcgaggaatatctgcgtacgcgttcg
ccggtgctggaaggctaa

DBGET integrated database retrieval system