KEGG   Burkholderia phenoliruptrix: BUPH_03023Help
Entry
BUPH_03023        CDS       T02300                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BUPH_03023
   00052 Galactose metabolism
    BUPH_03023
   00500 Starch and sucrose metabolism
    BUPH_03023
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_03023
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BUPH_03023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2958376..2959173
Genome map
AA seq 265 aa AA seqDB search
MLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLE
LVRSIKPSHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLYGTPPVMTQMIE
VFDHYHSSVIGVEEIPPQDTKSYGIVDGKEWEDSIIKMSGIVEKPEPSVAPSNLGVVGRY
VLKPRIFDHIRSLKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVE
FALRHPEVAADFEEYLRTRSPVLEG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgatcgtcgacaagccgctgattcaatacgcggtggaagaagccatggcggcc
ggcatcaccgaaatgatcttcgtcacgggccgcagtaaacgggcgatcgaggaccatttc
gacaagtcatacgaaatcgaagccgagctcgaggcacgcggcaaggacaagctgctggaa
ctcgtgcgcagcatcaagccgagtcacgtcgactgtttctacgtacgtcagcccgaagcg
ctcggcctcggccacgcggtgctgtgcgcggagaagctggtgggcgacaatccgttcgcc
gtgattctcgcggacgacctgctgtacggcacgccgcccgtcatgacgcagatgatcgag
gtgttcgaccactatcacagctccgtgattggcgtcgaagaaatcccgccgcaggacacc
aagtcgtacggtattgtcgacggcaaggaatgggaagactcgatcatcaagatgtcgggc
atcgtcgagaagccggagccgagcgtcgcgccgtccaatctcggcgtggtgggccgctat
gtgctgaagccgcgcattttcgaccacatccgttccctcaagccgggcgcgggcggcgaa
ctgcagctcacggacgccatccagtcgctgctcgccgacgaacaggtgctcgcatacaag
tatcacggcacgcgtttcgactgcggcagcaagctcggctatctgaaggcgacggtggaa
ttcgcgctgcgccatccggaagtggctgcggatttcgaggaatatctgcgtacgcgttcg
ccggtgctggaaggctaa

DBGET integrated database retrieval system