KEGG   Burkholderia phenoliruptrix: BUPH_03023Help
Entry
BUPH_03023        CDS       T02300                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bpx00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpx00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpx00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpx00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2958376..2959173
Genome map
AA seq 265 aa AA seqDB search
MLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLE
LVRSIKPSHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLYGTPPVMTQMIE
VFDHYHSSVIGVEEIPPQDTKSYGIVDGKEWEDSIIKMSGIVEKPEPSVAPSNLGVVGRY
VLKPRIFDHIRSLKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVE
FALRHPEVAADFEEYLRTRSPVLEG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgatcgtcgacaagccgctgattcaatacgcggtggaagaagccatggcggcc
ggcatcaccgaaatgatcttcgtcacgggccgcagtaaacgggcgatcgaggaccatttc
gacaagtcatacgaaatcgaagccgagctcgaggcacgcggcaaggacaagctgctggaa
ctcgtgcgcagcatcaagccgagtcacgtcgactgtttctacgtacgtcagcccgaagcg
ctcggcctcggccacgcggtgctgtgcgcggagaagctggtgggcgacaatccgttcgcc
gtgattctcgcggacgacctgctgtacggcacgccgcccgtcatgacgcagatgatcgag
gtgttcgaccactatcacagctccgtgattggcgtcgaagaaatcccgccgcaggacacc
aagtcgtacggtattgtcgacggcaaggaatgggaagactcgatcatcaagatgtcgggc
atcgtcgagaagccggagccgagcgtcgcgccgtccaatctcggcgtggtgggccgctat
gtgctgaagccgcgcattttcgaccacatccgttccctcaagccgggcgcgggcggcgaa
ctgcagctcacggacgccatccagtcgctgctcgccgacgaacaggtgctcgcatacaag
tatcacggcacgcgtttcgactgcggcagcaagctcggctatctgaaggcgacggtggaa
ttcgcgctgcgccatccggaagtggctgcggatttcgaggaatatctgcgtacgcgttcg
ccggtgctggaaggctaa

DBGET integrated database retrieval system