KEGG   Burkholderia phenoliruptrix: BUPH_03054Help
Entry
BUPH_03054        CDS       T02300                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpx  Burkholderia phenoliruptrix
Brite
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BUPH_03054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2994272..2995585)
Genome map
AA seq 437 aa AA seqDB search
MAAVAASAGLAGCDSGAPAVAADVGASAQHAPANPPAVAIAAQALKVVAAREAAPNGGQT
RAQVYESVRKMTALGKQLFFDPSLSGSGKLACASCHSPDHGFAPANALSVQLGGNDMHRT
GMRAAPTLKYLQAVPAFAEHYHESDDEGDESVDAGPTGGLTWDGRVDRGGDQARIPLLSS
FEMGSSPAKVSAAIKAAPYAADFRAAFGEHILDSDDATFKAVLQALETFEQTPELFYPYS
SKYDAYLAGKAQLTQAELHGLQLFNDEKKGNCASCHISQRSRDGAPPQFSDFGLIAIGVP
RNRALAVNRDPRFYDLGACGPERTDLKGRAEFCGIFRTPTLRNVALKKSFFHNGIYHSLE
EVLHFYAERDTNPGKFYPVVKGKVQKFDDLPKRYWANLNTEPPFDRKPGDQPAFDEAEIK
DIVAFLNTLTDGYKAGH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttggcggcggtggcggcgagcgccgggctcgcgggttgcgattcgggcgcgccggctgtt
gccgcggacgtgggcgcgagcgcccagcacgcgccggcgaatccgcctgcggtggcgatt
gccgcgcaggcgctgaaagtggtggccgctcgcgaagcggcgccgaacggcggtcaaacg
cgcgcgcaagtctacgaatcggtgcgcaagatgaccgcgctcggcaagcaattgttcttc
gacccgtcgctctccggttccggcaagctcgcgtgtgcgtcgtgccacagcccggaccac
gggtttgcgccggccaacgcgttgtccgtgcaactgggcggcaacgacatgcatcggacg
ggcatgcgcgccgcgccgacgctcaagtatctgcaagcggtgccggcgttcgccgagcac
tatcacgagtccgacgacgaaggcgacgagagcgtcgacgcgggcccgaccggcgggctc
acatgggacggccgcgtggatcgcggcggcgaccaggcgcgtattccgctgctgtcgtcg
ttcgagatgggcagttcgcccgcgaaggtgagcgcggcgatcaaggccgcgccctatgcc
gccgattttcgagcagcatttggcgaacatattctggatagcgacgacgcgaccttcaag
gcggttctgcaggcgctcgaaaccttcgagcagacgcccgaactgttctacccgtacagc
agcaaatacgacgcctatctggcgggcaaggcgcagctcacccaggccgagctgcacggt
ctgcaacttttcaacgacgaaaagaagggcaattgcgcgagctgccacattagccagcgc
agccgggacggcgcgccgccgcagttcagcgacttcggcctgatcgcgatcggcgtgccg
cgcaaccgcgcgctcgccgtgaatcgcgatccccgtttctacgacctgggcgcgtgcggt
ccggagcgcaccgatctcaagggacgcgcggagttctgcggcatcttccgcacgccgacg
ctgcgcaacgtcgcgttgaaaaagagcttctttcacaacggcatctatcactcgctcgaa
gaggtgctgcacttctatgccgagcgcgacacgaatcccgggaagttctatccggtcgtg
aagggcaaggtgcagaagttcgacgatttgccgaagcgctattgggcgaatctgaacacc
gagccgccgttcgaccgcaagcccggcgaccagcccgcgttcgacgaggccgagatcaag
gacatagtcgcgtttctgaacacgctcaccgacggctacaaggcagggcactga

DBGET integrated database retrieval system