KEGG   Burkholderia phenoliruptrix: BUPH_03105Help
Entry
BUPH_03105        CDS       T02300                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_03105
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BUPH_03105
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BUPH_03105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3062516..3063544)
Genome map
AA seq 342 aa AA seqDB search
MKTIPGPVMLDVVGKTLNDDDKRRLAHPMTGGVILFARHYESRAQLIALTDSIRAIREDL
LIAVDHEGGRVQRFRTDGFTVLPAMGKLGALWDSDVLHATKVATAVGYILASELRACGID
MSFTPVLDLNYGQSQVIGDRAFHSDPRVVTLLAKSLNHGLALAGMSNCGKHFPGHGFAHA
DSHVAMPVDDRSLDEILRDDVAPYDWLGLALGSVIPAHVVYPQVDSKPAGFSRVWLQDIL
RGKLRFEGAIFSDDLSMEAARQGGTLTEGATAALQAGCDMVLICNQPDQAEKVLDELRFT
PSKESQQRLKRMRARGKPIKWSKLIAQPQYLQAQALLRSVFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccattcccggaccggtcatgctcgacgtggtcggcaaaacgctgaacgacgac
gacaagcgccgccttgctcacccgatgaccggcggcgtgatcctgttcgcgcgccactac
gaaagccgcgcgcaactgatcgcgttgaccgattcgatccgcgcgattcgcgaggatctg
ctgattgccgtcgatcacgaaggcggacgcgtgcagcgcttccgcacggacggcttcacg
gtgcttccggccatgggcaagctcggcgcgctgtgggacagcgacgtgctgcatgccacc
aaggtcgccaccgcggtcggctatatccttgcatcggagctgcgcgcttgcgggatcgac
atgagctttacgccagtgctcgacctgaattacggtcagtcgcaggtgatcggcgatcgc
gcgttccacagcgatccgcgcgtggtgacgctgctcgcgaaaagcctcaaccacggtctt
gcgctcgccggcatgagcaattgcggcaagcatttcccggggcatggtttcgcgcatgcg
gattcgcacgtcgcgatgcccgtcgacgaccgttcgctcgacgaaatcctgcgcgacgat
gtcgcgccttatgactggctaggcctcgcgctcggctcggtgatcccggcgcatgtggtg
tatccgcaagtcgattcgaagccggcgggtttttcgcgcgtgtggctgcaggacatactg
cgcggcaagctgcgtttcgagggcgcgattttcagcgacgacctctcgatggaagccgcg
cgccagggcggcacgctcaccgaaggcgcgactgccgcgctgcaagccggctgcgacatg
gtgctgatctgcaatcagcccgaccaggccgaaaaggtgctggacgagttgcgctttacg
ccgtcgaaggaatcgcagcagcgcttgaagcgcatgcgggctcgcggcaagccgatcaag
tggagcaagctgatcgcgcagccgcagtatctgcaagcgcaggcgctgctgcgcagcgtg
ttcgcctga

DBGET integrated database retrieval system