KEGG   Burkholderia phenoliruptrix: BUPH_03166Help
Entry
BUPH_03166        CDS       T02300                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpx00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bpx00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3128255..3128755
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARANNGVIGRDNQLPWRLPEDLAFFKRTTMGAPIIMGRKTHESIGRPLPGRR
NIVVTRDATRRFQGCDAATTLDEALKLAAQDQAPEAFLIGGAQLYVEGLRLADKLIVTEI
SADFQGDATFPAVDPDEWEEVAHETHRADAPNDFDYAFVTYRRKSH
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctcactctgatcgtcgctcgcgccaacaacggcgtgatcggccgcgacaac
cagttgccctggcgacttcccgaagacctcgcttttttcaagcgcacgaccatgggcgcg
cccatcatcatggggcgcaagacgcacgagtcgatcggcaggccattgccgggacgccgc
aacattgtcgtgacgcgcgacgcgacgcggcgcttccagggctgcgacgccgccaccacg
ctcgacgaagcgctgaagctcgccgcccaggatcaggcacccgaagcgtttctgatcggc
ggcgcgcagttgtatgtggaaggactgcgtctggcggacaaactgatcgtcaccgagatt
tcggccgattttcagggcgacgcaacgttccccgcagtcgaccctgacgagtgggaagaa
gtcgcgcacgaaacgcaccgcgcggatgcgccgaacgatttcgactacgcgttcgtgacc
tacaggcgcaagagccactga

DBGET integrated database retrieval system