KEGG   Burkholderia phenoliruptrix: BUPH_03493Help
Entry
BUPH_03493        CDS       T02300                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BUPH_03493
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BUPH_03493
Exosome [BR:bpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUPH_03493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3498373..3499872
Genome map
AA seq 499 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRLGNVVSTAQKEFEQIYPRPGWVEHDPQEIWSTQAGVA
AEAVTRAGMNGTSIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDQLKEQGL
EAKVRAKTGLPIDSYFSATKIRWILDNVEGAREKAKQGRLAFGTVDSWLVWNFTKGGLHV
TDVTNASRTMLFNIHTLKWDDELLEALDIPRSMLPEVRASSQVYGPTKTTVFASKIPLAG
IAGDQHAALFGQMCTQSGMVKNTYGTGCFLVMNTGDKPIESKNNLVTTIAWQIGDQINYA
LEGSIFIGGAVVQWLRDGLGIIKHAAEIEALAASVPHCDGVYLVPAFAGLGAPHWNARAR
GTLFGVTRGTTSAHIARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGACANNLLMQF
QADILGVDAVRPKVSETTALGAAYLAGLAVGYWKDVDELQSQWKLDRRFTPAREQADVQE
CLDGWKRAIRAAKAWADTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcagtacatcctcgcgcttgaccagggcaccaccagctcacgtgcgatgctg
ttcgaccgcctcggcaatgtcgtgtcgacggcgcaaaaggaattcgagcagatctatccg
cgtccgggctgggtcgagcacgatccgcaggaaatctggtcgacgcaggccggcgtcgcc
gccgaggccgtgacgcgcgccggcatgaacggcacgtcgatcgccgcgatcggcattacg
aatcagcgggaaaccaccatcgtgtgggaccgcgaaaccgggcaccccatctacaacgcc
atcgtgtggcaagaccgccgcaccgccgacttctgcgaccagctcaaggaacagggcctc
gaggcgaaggtgcgcgcgaaaaccggcttgccgatcgactcgtatttttccgcgaccaag
atccgctggattctcgacaacgtcgaaggcgcgcgcgagaaggcaaagcaaggccggctc
gcgttcggcacggtggacagctggctcgtgtggaatttcaccaagggcggcctgcacgtc
accgacgtcaccaatgcctcgcgcacgatgctcttcaacatccacacgctgaagtgggac
gacgaactgctcgaggcgctcgacattccgcgcagcatgttgccggaagtgcgggcgtcg
tcgcaagtgtatgggccgaccaaaacgacggtgttcgcgtcgaagattccgctcgcgggc
atcgccggcgaccagcatgccgcgcttttcggccagatgtgcacgcaatccggcatggtg
aagaacacctacggcaccggctgcttcctcgtgatgaacaccggcgacaagccgatcgaa
tcgaagaacaatctcgtcacgacgattgcgtggcaaatcggcgaccagatcaactacgcg
ctcgaaggcagcatcttcatcggcggcgcggtcgtgcaatggctgcgcgacggtctcggc
atcatcaaacatgccgctgagatcgaggcgctcgcggcgagcgtgccgcattgcgacggc
gtctacctcgtgcccgcattcgccggcctcggcgccccgcattggaatgcacgcgctcgc
ggcacgctgttcggcgtgacgcgcggcacgacgtccgcgcatatcgcgcgcgccgcactc
gactcgatcgcctatcagtcgctcgacgtgctgaaggccatggaggccgactcgggcatt
cgcatcggcgaactgcgggtggacggcggcgcgtgcgcgaacaatctgctgatgcagttc
caggcggacattctcggcgtggacgcggtccgcccgaaggtgtcggaaaccaccgcgctc
ggcgccgcgtatctggcgggcctcgcggtcggctactggaaagacgtcgacgaactgcaa
agccagtggaagctcgaccggcgcttcacgcccgcgcgcgagcaagcggacgtgcaggaa
tgtctggacggctggaagcgcgcgattcgcgccgccaaggcatgggccgacacgccctga

DBGET integrated database retrieval system