KEGG   Paraburkholderia phenoliruptrix: BUPH_04522Help
Entry
BUPH_04522        CDS       T02300                                 

Definition
(GenBank) threoninee synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00260  Glycine, serine and threonine metabolism
bpx00750  Vitamin B6 metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01230  Biosynthesis of amino acids
Module
bpx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUPH_04522
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BUPH_04522
Enzymes [BR:bpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BUPH_04522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFT84757
UniProt: K0DJ35
Position
1:694889..695815
Genome map
AA seq 308 aa AA seqDB search
MQKTWGEHRPHFKLEWFSPTSSFKDRGTTVMLSMLRQQGVTSVLEDSSGNGGASVAAYGA
AGAVRVKILAPAYASPAKIAQMRAYGAEVQLVDGPRQACEDEAVRQSASIFYASHNWQPF
FLEGTKSVGYEIWEDLNFQAPDNIVMPAGAGSNVLGCYLAFSELMRAGQISKMPRLFVCQ
PLNCSPIDASFQAGVTTPVAREVRKTVSEGTAIAHPLRLAQVVNAVRETGGTTVAVDEEA
IVEALRRIARLGLLPELTSATAVAGFDRLTRVGAIQAREETVVLLTGTGIKNAEAIADMY
SDTPKALV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagacatggggcgagcaccggccgcatttcaagctggagtggttcagccccacc
agcagcttcaaggatcgcggcaccacggtgatgctgtcgatgttacggcaacaaggcgtc
acgtctgtgctggaagacagctcgggcaacggcggagcgtcggtggccgcttatggcgcc
gcgggcgcggtgcgcgtgaagattctggcgccagcctacgcgtctcccgcaaagatcgcc
cagatgcgcgcctacggggcggaggtgcaactggtcgatggacctcgacaggcgtgtgaa
gacgaggcagtccggcagtccgcgagcatcttctacgcgagccacaattggcagccgttt
ttcctcgaagggaccaagtcggtcggctacgagatctgggaggacctcaacttccaggcg
ccggacaacatcgttatgcctgcaggcgcgggcagcaatgtactcggctgctatctggcg
ttctcggaactgatgcgcgcgggccagatcagcaagatgcccaggcttttcgtttgccag
ccattgaactgctcgcccatcgatgccagttttcaggccggcgtcacgacgcccgttgcg
cgcgaggttcgaaagaccgtctctgaggggacggccatcgcccatcctctgcggctcgcg
caggtggtcaacgctgtcagggagacgggcggcacgactgtcgctgtggacgaagaggca
atcgtcgaagcgctcaggcggattgcgcgactgggacttctgccggagctgacttcggcg
actgcggttgcaggatttgatcggcttactcgagtcggggcgattcaggcgcgagaggag
acggttgtcctcttgacgggcacgggcatcaaaaacgccgaagctattgcggatatgtac
tcggacactcccaaggctcttgtctaa

DBGET integrated database retrieval system