KEGG   Burkholderia phenoliruptrix: BUPH_04522Help
Entry
BUPH_04522        CDS       T02300                                 

Definition
(RefSeq) threoninee synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUPH_04522
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUPH_04522
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BUPH_04522
Enzymes [BR:bpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BUPH_04522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:694889..695815
Genome map
AA seq 308 aa AA seqDB search
MQKTWGEHRPHFKLEWFSPTSSFKDRGTTVMLSMLRQQGVTSVLEDSSGNGGASVAAYGA
AGAVRVKILAPAYASPAKIAQMRAYGAEVQLVDGPRQACEDEAVRQSASIFYASHNWQPF
FLEGTKSVGYEIWEDLNFQAPDNIVMPAGAGSNVLGCYLAFSELMRAGQISKMPRLFVCQ
PLNCSPIDASFQAGVTTPVAREVRKTVSEGTAIAHPLRLAQVVNAVRETGGTTVAVDEEA
IVEALRRIARLGLLPELTSATAVAGFDRLTRVGAIQAREETVVLLTGTGIKNAEAIADMY
SDTPKALV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagacatggggcgagcaccggccgcatttcaagctggagtggttcagccccacc
agcagcttcaaggatcgcggcaccacggtgatgctgtcgatgttacggcaacaaggcgtc
acgtctgtgctggaagacagctcgggcaacggcggagcgtcggtggccgcttatggcgcc
gcgggcgcggtgcgcgtgaagattctggcgccagcctacgcgtctcccgcaaagatcgcc
cagatgcgcgcctacggggcggaggtgcaactggtcgatggacctcgacaggcgtgtgaa
gacgaggcagtccggcagtccgcgagcatcttctacgcgagccacaattggcagccgttt
ttcctcgaagggaccaagtcggtcggctacgagatctgggaggacctcaacttccaggcg
ccggacaacatcgttatgcctgcaggcgcgggcagcaatgtactcggctgctatctggcg
ttctcggaactgatgcgcgcgggccagatcagcaagatgcccaggcttttcgtttgccag
ccattgaactgctcgcccatcgatgccagttttcaggccggcgtcacgacgcccgttgcg
cgcgaggttcgaaagaccgtctctgaggggacggccatcgcccatcctctgcggctcgcg
caggtggtcaacgctgtcagggagacgggcggcacgactgtcgctgtggacgaagaggca
atcgtcgaagcgctcaggcggattgcgcgactgggacttctgccggagctgacttcggcg
actgcggttgcaggatttgatcggcttactcgagtcggggcgattcaggcgcgagaggag
acggttgtcctcttgacgggcacgggcatcaaaaacgccgaagctattgcggatatgtac
tcggacactcccaaggctcttgtctaa

DBGET integrated database retrieval system