KEGG   Burkholderia phenoliruptrix: BUPH_04724Help
Entry
BUPH_04724        CDS       T02300                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpx  Burkholderia phenoliruptrix
Brite
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BUPH_04724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMBR3459:1771..3153
Genome map
AA seq 460 aa AA seqDB search
MKKLLIASIAFVLVGYLSISGIAYVHDKDYAERAVARPAVSPQAFGVRDVLDRNACYYCH
SRKAVLPNYAALPGIRQLAEHDRQTGLAYFRIDSLYAALESGMPAPEADLAKLETVVNEL
AMPPKLFRLVHWTTGLRTDDQRALLDWIASQRRAYATRGVAPEFANEPVQPLPDSLPTDM
GKVALGRQLFNDVRLSADNTISCASCHTLSTGGVDGKKVSSGVGGQLGLVNAPTVFNAAL
NDKQFWDGRAATLQEQAGGPPLNPVEMASRSWSEIIDKLKQDSSLTQQFLTVYRDGWSGA
NITDAIAQYETTLLTPSRFDTYLRGDRHALNSEELRGYHLFKANHCATCHVGKNLGGRSF
ERMGLAADYFAARGYTSTADNGRANVTNDALDRHAFKTPTLRNVELTAPYFHDGSRTNLH
EAVRDMATYQVGKQLSDSDVNAIVAFLKTLTGTRQPVATH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaacttctgatcgcgtcgatcgccttcgtgctggttggctatctcagtattagc
ggtatcgcgtatgtacacgacaaggactatgcggagagagcggtcgcgaggccggccgta
tccccacaagcgttcggcgtacgcgacgtgttagatcgtaacgcatgctattactgccat
tcgaggaaagctgtcctacctaactatgccgcgctaccaggcattcgtcagctagccgaa
catgacaggcaaactggactcgcctacttccgcatcgacagcctgtacgcggcgctcgaa
agcggcatgccagctcccgaagccgatcttgcgaagctggaaaccgttgtgaacgaactc
gccatgccaccaaagttgttccgcctcgtacactggacaaccggactgaggaccgacgat
caacgcgcgctgctcgactggatagcgtcacaacgccgcgcatatgcgacgcgcggcgtt
gcaccggaattcgctaacgagcctgtgcaaccgttgccagattctttgccgaccgacatg
ggtaaggtcgcgcttggaaggcagctcttcaacgatgtccgactatcggcggacaacacg
atatcgtgtgcaagctgccacacgctgtcgacagggggcgtagacggaaagaaggtttcg
tccggtgtgggcggacagttgggcttggtcaacgcgccgacggtgttcaacgcggcgctc
aacgacaagcagttctgggacggtcgcgctgccacgctgcaggaacaggcgggcggtcca
ccgctgaatccggtcgaaatggcgtctaggtcatggagtgaaatcatcgataagctgaag
caggactcgtcactgacacaacagttcctgacggtgtaccgggacggttggtcgggcgcg
aacatcacagacgcgatcgcccaatatgagacgacactgctaacgccgagtcgcttcgat
acttacttgcgcggcgacaggcatgcgctgaatagcgaagaactgcgcggctaccactta
ttcaaggcgaaccattgcgcgacctgtcatgttggcaagaatctgggcgggcggtcgttc
gagcgaatgggcctcgcggccgactacttcgccgcgcggggctatacctccaccgcggat
aacggtcgggcgaacgttacgaacgacgcgctcgaccgccatgcgttcaagacgccgacg
ctgcgcaacgtggaactgaccgcgccatattttcacgacggcagccgtaccaatctgcac
gaagctgtgcgtgacatggcgacgtatcaggtcggtaagcaattgtcggactcggatgtc
aacgcaatcgtagcgttcctgaagacgctaacaggcacgcgccaacccgtcgcgacccac
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system