KEGG   Burkholderia phenoliruptrix: BUPH_05286Help
Entry
BUPH_05286        CDS       T02300                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BUPH_05286
Enzymes [BR:bpx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BUPH_05286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1070207..1070911
Genome map
AA seq 234 aa AA seqDB search
MTDLSAFPITKKWPAEHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQMTP
EFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVM
FQMGGIGPMFGQVGFFHKFAGKEYEDKRPRDRYVAESRRLLGVLEQRLQGREWILGDQYS
IADIATFPWVRNLIGFYEAGELVRIEDFPNVRRVLAAFVARPAVIRGLDSPKRG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacagatctgtccgcctttccgattacgaaaaaatggcctgccgagcatcccgagcgc
cttcaactttactcgctgcccacgccgaacggcgtgaaagtgtcgatcatgctcgaagaa
accggcttgccttacgagccgcatctggtgcgtttcgacaccaacgaccagatgacgccg
gagttcatgtcgctgaatccgaacaacaagattccggcgatcatcgatccgaacggcccg
gacggcaagcctttgccgctcttcgaatccggcgcgatcctgatctatctcgcggacaag
accgggcagctgattccgcaggacgccgccggccgctacgaggccatccaatgggtgatg
ttccagatgggcggcatcggcccgatgttcggccaggtcggctttttccacaaattcgcg
ggcaaggagtatgaagacaagcgcccgcgcgatcgctatgtcgccgaatcgaggcgtttg
ctcggtgtgctcgaacagcgtctgcaaggacgcgagtggattctcggcgatcagtactcg
attgccgatatcgcgacgtttccgtgggtgcgcaatctgatcggtttctatgaagcgggc
gaactggtgcgcatcgaggactttccgaacgtgaggcgcgtgctggcggcgttcgtcgcg
cggccggcggtgatccgcggcctggatagtccgaagcggggatag

DBGET integrated database retrieval system