KEGG   Paraburkholderia phenoliruptrix: BUPH_05286Help
Entry
BUPH_05286        CDS       T02300                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BUPH_05286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1070207..1070911
Genome map
AA seq 234 aa AA seqDB search
MTDLSAFPITKKWPAEHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQMTP
EFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVM
FQMGGIGPMFGQVGFFHKFAGKEYEDKRPRDRYVAESRRLLGVLEQRLQGREWILGDQYS
IADIATFPWVRNLIGFYEAGELVRIEDFPNVRRVLAAFVARPAVIRGLDSPKRG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacagatctgtccgcctttccgattacgaaaaaatggcctgccgagcatcccgagcgc
cttcaactttactcgctgcccacgccgaacggcgtgaaagtgtcgatcatgctcgaagaa
accggcttgccttacgagccgcatctggtgcgtttcgacaccaacgaccagatgacgccg
gagttcatgtcgctgaatccgaacaacaagattccggcgatcatcgatccgaacggcccg
gacggcaagcctttgccgctcttcgaatccggcgcgatcctgatctatctcgcggacaag
accgggcagctgattccgcaggacgccgccggccgctacgaggccatccaatgggtgatg
ttccagatgggcggcatcggcccgatgttcggccaggtcggctttttccacaaattcgcg
ggcaaggagtatgaagacaagcgcccgcgcgatcgctatgtcgccgaatcgaggcgtttg
ctcggtgtgctcgaacagcgtctgcaaggacgcgagtggattctcggcgatcagtactcg
attgccgatatcgcgacgtttccgtgggtgcgcaatctgatcggtttctatgaagcgggc
gaactggtgcgcatcgaggactttccgaacgtgaggcgcgtgctggcggcgttcgtcgcg
cggccggcggtgatccgcggcctggatagtccgaagcggggatag

DBGET integrated database retrieval system