KEGG   Burkholderia phenoliruptrix: BUPH_05358Help
Entry
BUPH_05358        CDS       T02300                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BUPH_05358
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_05358
   00650 Butanoate metabolism
    BUPH_05358
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BUPH_05358
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUPH_05358
   00622 Xylene degradation
    BUPH_05358
   00621 Dioxin degradation
    BUPH_05358
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BUPH_05358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:995683..996645
Genome map
AA seq 320 aa AA seqDB search
MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARARRMGVATTAEGI
DGLLKLDAFKNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLETEN
ASNMNMVTCGGQATIPIVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTRSAI
ETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVSAVEDSVAQMIASVQAYVPGYRL
KQKIQFDIVSPEKPLNVPGVGAKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRLAAGIVRGRKETIQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaggtgaaagttgcgatcatcggtcccggcaacatcgggacagacctcatg
ataaaggtgatgcgcaacagccagcacctcgaaatggctgcgatggtgggtgtcgacccg
aaatcggatggactcgcgcgcgctcgaaggatgggcgtggcgacgacagcggaggggatc
gacgggctcttgaaactcgatgcgttcaagaacatcgatatcgtcttcgatgccacgtcg
gccagtgcgcacaagcatcacaacgatgtgctgcaaaagcacggcgtgcaggttatcgac
ctgacgccggctgcggttggcccctatgtgattccggcgatcaatctcgagaccgaaaat
gcgtccaacatgaacatggtcacgtgcggcggccaggcgacgattccgatcgttgcagcc
gtgtcgcgtgtcgcgaaggtccattacgccgaaatcatcgcctctatctcgagcaaatct
gcggggccgggcacgcgggcaaacatcgacgagtttactgagaccacccgcagtgcaatc
gagacgctgggtggagcaactcgcggcaaggcaatcatcgtgctcaacccggcggagccg
ccattgatcatgcgcgataccgtgtttgtattgtctgatctggtagatgttagcgccgtt
gaggatagcgtcgcgcagatgattgccagcgtgcaggcttatgttcccggttatcgcctg
aaacagaagattcagttcgacattgtctcgccggaaaagccgctgaatgtgcctggtgtc
ggcgcaaagcacgggctgaagacgtcggtattccttgaagtagaaggtgccgcccattac
ctgccctcgtacgcgggcaatctcgacatcatgacctcggccgcgctcgcatgcggcgac
atgatggcacgccgacgcctagctgccggcatcgtccgaggccggaaggagactattcaa
tga

DBGET integrated database retrieval system