KEGG   Paraburkholderia phenoliruptrix: BUPH_05358Help
Entry
BUPH_05358        CDS       T02300                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00360  Phenylalanine metabolism
bpx00362  Benzoate degradation
bpx00620  Pyruvate metabolism
bpx00621  Dioxin degradation
bpx00622  Xylene degradation
bpx00650  Butanoate metabolism
bpx01100  Metabolic pathways
bpx01120  Microbial metabolism in diverse environments
bpx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_05358
   00650 Butanoate metabolism
    BUPH_05358
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BUPH_05358
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUPH_05358
   00622 Xylene degradation
    BUPH_05358
   00621 Dioxin degradation
    BUPH_05358
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BUPH_05358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N NAD_binding_3 F420_oxidored CoA_binding
Motif
Other DBs
NCBI-ProteinID: AFT84989
UniProt: K0DNG9
Position
1:995683..996645
Genome map
AA seq 320 aa AA seqDB search
MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARARRMGVATTAEGI
DGLLKLDAFKNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLETEN
ASNMNMVTCGGQATIPIVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTRSAI
ETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVSAVEDSVAQMIASVQAYVPGYRL
KQKIQFDIVSPEKPLNVPGVGAKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRLAAGIVRGRKETIQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaggtgaaagttgcgatcatcggtcccggcaacatcgggacagacctcatg
ataaaggtgatgcgcaacagccagcacctcgaaatggctgcgatggtgggtgtcgacccg
aaatcggatggactcgcgcgcgctcgaaggatgggcgtggcgacgacagcggaggggatc
gacgggctcttgaaactcgatgcgttcaagaacatcgatatcgtcttcgatgccacgtcg
gccagtgcgcacaagcatcacaacgatgtgctgcaaaagcacggcgtgcaggttatcgac
ctgacgccggctgcggttggcccctatgtgattccggcgatcaatctcgagaccgaaaat
gcgtccaacatgaacatggtcacgtgcggcggccaggcgacgattccgatcgttgcagcc
gtgtcgcgtgtcgcgaaggtccattacgccgaaatcatcgcctctatctcgagcaaatct
gcggggccgggcacgcgggcaaacatcgacgagtttactgagaccacccgcagtgcaatc
gagacgctgggtggagcaactcgcggcaaggcaatcatcgtgctcaacccggcggagccg
ccattgatcatgcgcgataccgtgtttgtattgtctgatctggtagatgttagcgccgtt
gaggatagcgtcgcgcagatgattgccagcgtgcaggcttatgttcccggttatcgcctg
aaacagaagattcagttcgacattgtctcgccggaaaagccgctgaatgtgcctggtgtc
ggcgcaaagcacgggctgaagacgtcggtattccttgaagtagaaggtgccgcccattac
ctgccctcgtacgcgggcaatctcgacatcatgacctcggccgcgctcgcatgcggcgac
atgatggcacgccgacgcctagctgccggcatcgtccgaggccggaaggagactattcaa
tga

DBGET integrated database retrieval system