KEGG   Burkholderia phenoliruptrix: BUPH_05367Help
Entry
BUPH_05367        CDS       T02300                                 

Definition
uroporphyrinogen III methyltransferase
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BUPH_05367
Enzymes [BR:bpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BUPH_05367
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BUPH_05367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:984407..986428
Genome map
AA seq 673 aa AA seqDB search
MAADIPRNASSSTAGKAAFTVVITRPAGQSSELIARLAAAGVAALDFPLIDIAPVADDAP
LRAALGSLERYALVVFVSPNAIDHAFAKSSAIWPHALPVGVVGPGSVRALARHGVSAPAH
QVISPAAGVDDDNGRFDSEGLFAAIDAALGEANLEGKRVLIVRGDGGREWLADRLREAGA
EVETVAAYRRLVPEPSIAAWARVHQLLAGEPHAWLLTSSEGVRNLHELAQEHLTADEIAQ
LKRATLVAPHPRIAQTARALGFDRITVSGAGDERIAQALLSALPTEVQPVPSNPAYSPAQ
SRMTETNASTNASPQPAATASLPPNPPFTPYEAQKRRSASGPLLWFVVVVLACAAGVGGY
ALNRKLERTEEQIAQRQQANDTQTNELRIKTEQALATVRQSDSQVAQLEGKLADAQAAQQ
ALQQQYADLARNRDDWTLAEVGQMLSAASQQLQLTGNTQLALFALQSADTRLAASDSAQA
VAVRKAIAQDIDKLKAAPSTDLTGLAIKLDNAVDQIDSLPLSGEAQIAHATPHATTWADT
AKVSAATGEPRWKVWWREVTSGIGQQLTSLVQVRRIDNADAMMVAPDQGYFVRENVKLRL
LSARLALLSRNETTLKSDLQAAQNALTRYFDASSKKTQNVVDLVKQVEAGSAAVELPNLN
TSLQAVNQYRSRG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgacattccgcgcaacgcgtcgtcatcaaccgccggtaaggcggcgttcacg
gtcgtcattacgcgaccggccggtcagtcgagcgaactgatcgcgcggttggccgcggcc
ggcgtcgccgcgctggactttccgctgatcgacatcgcccccgttgccgacgacgcgccg
ctgcgcgccgcgctcggttcgctggaacgttacgcgctcgtcgtgttcgtctcgccgaat
gcgatcgatcacgcgttcgctaaaagcagcgcgatctggccgcatgcgttgccggtcggc
gtggtcgggccgggcagcgtgcgcgcgctcgcgcgtcacggcgtgagtgcgcccgcgcat
caggtgatcagtccggcggcgggcgtggatgacgacaacggccgcttcgattccgaaggc
ctcttcgccgccatcgacgcagcgctcggcgaagcgaatctggaaggtaagcgcgtgctc
atcgtgcgcggcgacggcggccgcgagtggctcgcggatcgtctgcgcgaagcgggcgcc
gaagtggagacggtcgcggcataccggcgcctcgtgccggagccgtccatcgcggcgtgg
gcgcgcgtgcatcagctgctcgcgggcgaaccgcacgcgtggctcctgaccagttccgag
ggcgtgcgcaatctgcacgaactcgcgcaagaacatctcaccgccgacgaaatcgcgcag
ttaaagcgcgccacgctcgtcgcgccgcatccccgtatcgcgcagaccgcgcgggcattg
ggttttgataggattacggtgtccggcgcgggcgacgagcgcatcgcccaagccttgctc
tccgcgctgccgaccgaagttcaaccggtaccgtccaatccggcttattcaccggctcaa
tcacgcatgactgaaacgaacgcatccacgaacgcttcaccccagccggccgcgactgca
agcttgccgccgaacccacccttcacgccctacgaagcgcaaaagcgccgcagcgcgagc
ggaccgctgctgtggtttgtcgtcgtggttctggcttgcgccgcgggcgtgggcggctat
gcgctcaatcgcaagctcgagcgcaccgaggagcagatcgcgcaacgccagcaggcgaac
gacacgcagaccaacgaactgcgcatcaagaccgagcaggcgcttgccacggtgcgtcag
tccgactcgcaggtcgcgcaactggaaggcaagctcgccgatgcgcaggccgcgcagcag
gcgctgcaacaacaatacgcggatctcgcgcgcaatcgcgacgactggacgctcgccgaa
gtcggccagatgctgtccgccgcgagccagcaattgcagctgaccggcaacacgcaactc
gcgctcttcgcgctgcaaagcgccgacacgcggctcgcggcgtcggacagcgcgcaggcg
gtggcggtgcgcaaggcgattgcgcaggacatcgacaagctgaaggctgcgccttccacc
gatctcacgggtcttgccatcaagctcgacaacgcggtggatcagatcgacagcctgccg
ctctcgggcgaggcgcagatcgcgcacgccacgccgcacgcgacgacatgggccgacacg
gcgaaggtctcggcggccaccggcgagccgcgctggaaagtgtggtggcgcgaagtgacg
agcggcatcggccagcagttgacgagcctcgtgcaggtacgccgcatcgacaacgcggac
gcgatgatggtcgcgcccgaccagggctatttcgtgcgtgagaatgtgaagctgcgtttg
ctgtcggcgcggctcgcgctgttgtcgcgcaacgagaccacgctcaagtccgacctgcag
gcggcgcagaatgcgttgacgcgttatttcgatgcatcgtcgaagaaaacgcagaacgtg
gtcgatctggtcaagcaggtcgaggccggctccgccgccgtcgaattgcctaatctgaat
acgagcctgcaagccgtcaatcaataccggagccgaggttaa

DBGET integrated database retrieval system