KEGG   Burkholderia phenoliruptrix: BUPH_05387Help
Entry
BUPH_05387        CDS       T02300                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BUPH_05387
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BUPH_05387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:960270..961262
Genome map
AA seq 330 aa AA seqDB search
MNTSSFISPEAGERPQPLSGNAMPRCGGIATMMRLPNVGSAAGFDACFVGVPFDLGTSNR
TGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLQDSIARIESAYDE
ILQHDCKPVTLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRR
AVEEGLLDCERVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLAPLMARVRERMG
DAPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDP
FGTTALLGANLAFELLCVLPGVEYRSAAAR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcctccttcatttcccccgaagccggtgagcgcccccagccgctgtccggc
aatgcgatgccgcgctgcggcggaatcgcgaccatgatgcgtttgccgaacgtcggctcg
gctgcgggattcgacgcctgtttcgtcggtgtgccgttcgatctcggcacgtcgaaccgc
acgggcgcgcgtttcgggccgcgtcagatccgcagcgaatcggtgctgctgcggccgtac
aacatggcgacgcgtgcggcgccgttcgattcgctgcgcgtggccgatctcggcgacgtc
gcgatcaacccgtacaacctgcaggactcgatcgcgcgaatcgaaagcgcttacgacgaa
attctccagcacgattgcaagccggtcacgctcggcggcgatcacacgatcgcgctaccg
atcctgcgcgcgattcatcgcaagcatggcaaggtggggctgattcacgtggacgcgcat
gccgacgtcaacgacacgatgatgggcgagaagatcgcgcacggcacgccgtttcggcgc
gcggtggaggaaggtttgctcgactgcgagcgcgtcgtgcagatcggtctgcgcggcacg
ggttacgcggcggaggacttcgactggtgccgcgaccagggcttcgaagtcgtgcaggcg
gaggcgtgctggaaccagtcgcttgcgccgctgatggcgcgcgtgcgcgagcgcatgggc
gacgcgccggtgtacatcacgttcgacatcgacggaatcgatccggccttcgcgcccggc
acgggcacgccggaaatcgccggactgacggtgccgcaggcgctcgagatcattcgcggc
gcgcgcggcctgaatatcgtcggttgcgatcttgtggaagtcgcgccgccgtacgatccg
ttcggcacgaccgcgctgctgggcgcgaacctcgcgttcgagttgttgtgcgtgctgccg
ggcgtcgaataccggagcgccgcggcgcgttag

DBGET integrated database retrieval system