KEGG   Burkholderia phenoliruptrix: BUPH_05387Help
Entry
BUPH_05387        CDS       T02300                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpx00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:960270..961262
Genome map
AA seq 330 aa AA seqDB search
MNTSSFISPEAGERPQPLSGNAMPRCGGIATMMRLPNVGSAAGFDACFVGVPFDLGTSNR
TGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLQDSIARIESAYDE
ILQHDCKPVTLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRR
AVEEGLLDCERVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLAPLMARVRERMG
DAPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDP
FGTTALLGANLAFELLCVLPGVEYRSAAAR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcctccttcatttcccccgaagccggtgagcgcccccagccgctgtccggc
aatgcgatgccgcgctgcggcggaatcgcgaccatgatgcgtttgccgaacgtcggctcg
gctgcgggattcgacgcctgtttcgtcggtgtgccgttcgatctcggcacgtcgaaccgc
acgggcgcgcgtttcgggccgcgtcagatccgcagcgaatcggtgctgctgcggccgtac
aacatggcgacgcgtgcggcgccgttcgattcgctgcgcgtggccgatctcggcgacgtc
gcgatcaacccgtacaacctgcaggactcgatcgcgcgaatcgaaagcgcttacgacgaa
attctccagcacgattgcaagccggtcacgctcggcggcgatcacacgatcgcgctaccg
atcctgcgcgcgattcatcgcaagcatggcaaggtggggctgattcacgtggacgcgcat
gccgacgtcaacgacacgatgatgggcgagaagatcgcgcacggcacgccgtttcggcgc
gcggtggaggaaggtttgctcgactgcgagcgcgtcgtgcagatcggtctgcgcggcacg
ggttacgcggcggaggacttcgactggtgccgcgaccagggcttcgaagtcgtgcaggcg
gaggcgtgctggaaccagtcgcttgcgccgctgatggcgcgcgtgcgcgagcgcatgggc
gacgcgccggtgtacatcacgttcgacatcgacggaatcgatccggccttcgcgcccggc
acgggcacgccggaaatcgccggactgacggtgccgcaggcgctcgagatcattcgcggc
gcgcgcggcctgaatatcgtcggttgcgatcttgtggaagtcgcgccgccgtacgatccg
ttcggcacgaccgcgctgctgggcgcgaacctcgcgttcgagttgttgtgcgtgctgccg
ggcgtcgaataccggagcgccgcggcgcgttag

DBGET integrated database retrieval system