KEGG   Burkholderia phenoliruptrix: BUPH_05402Help
Entry
BUPH_05402        CDS       T02300                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUPH_05402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUPH_05402
   00052 Galactose metabolism
    BUPH_05402
   00500 Starch and sucrose metabolism
    BUPH_05402
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_05402
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BUPH_05402
   00524 Butirosin and neomycin biosynthesis
    BUPH_05402
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BUPH_05402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(941548..943452)
Genome map
AA seq 634 aa AA seqDB search
MQTKAVPGAGQHADGPRLLADIGGTNARFALETGPGEIGSVQVYPCAEFPGVADVIKKYL
KDTKIGRVNHAAIAIANPVDGDQVSMTNHDWTFSIEATRRALGFDTLLVVNDFTALAMAL
PGLTDAQRVQVGGGTRRPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFAPADE
REDIVLHYARKKWSHVSFERVAAGPGLEVIYRALAGRDKKRVAANVDTREIVRRALDGEP
LAAESVDVFCGILGTFAGNIAVTLGALGGIYIGGGVVPRLGEFFARSSFRKRFEAKGRFE
AYLQNVPTYVITAEYPAFLGVSAILAEQLSNRAGGSSSAVFERIRQMRDALTPAERRVAD
LALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPVSHS
QVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVERAIDLLNGARRIEFYGLGNSNIVA
QDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGA
KVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLVMIDILAVGVAIRRAAPSA
DVAEAVAKVRQGADDDATAVLDWLSHGAASSARD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaactaaggctgttccgggcgcgggccagcacgccgacggaccgaggctgctcgcc
gacatcggcggcaccaatgcgcgctttgcgctggaaaccggaccgggagaaatcggctcg
gtgcaggtttatccgtgcgcggagttccccggtgtcgccgacgtcatcaagaagtatctg
aaggacacgaagatcggccgcgtgaatcatgcggcgattgcgattgcgaacccggtcgac
ggcgaccaggtcagcatgacgaatcacgactggaccttctcgattgaagccacgcgccgc
gcgctcggcttcgacacgctgctcgtcgtgaacgacttcaccgcgctcgccatggccctg
ccgggcctgaccgacgcgcagcgcgtgcaggtgggcggcggcacgcgccgcccgaacagc
gtgatcggcctgctcggccctggtacgggcatgggcgtgtcgggtctgattcccgccgac
gaccgctggatcgcgctcggcagcgaaggcggccacgccacgttcgcgccggccgacgag
cgcgaagacatcgtgctgcactacgcgcgcaagaagtggtcgcacgtgtcgttcgaacgt
gtggccgcgggccccggcctcgaagtgatttaccgcgcgctcgcgggccgcgacaagaag
cgcgtggcggcgaacgtggatacccgcgagatcgtcagacgcgcgctggacggcgagccg
ctcgccgccgaatccgtcgacgtgttctgcggcattctcggcaccttcgcgggcaatatc
gcggtgacgctgggcgcgctcggcggcatttacattggcggcggcgtggtgccgcggctc
ggcgagttcttcgcgcgctcgtcgtttcgcaagcgcttcgaggcgaagggccgcttcgaa
gcctatctgcagaacgtgccgacctatgtgattaccgcggaatatcccgcgtttctcggt
gtctcggcgattctcgcggagcagttgtcgaaccgcgcgggcggcagttcgtcggcggta
ttcgagcggatccggcagatgcgcgacgcgttgacgccggccgagcgccgcgtcgccgat
ctcgcgctgaaccacccgcgctcgatcatcaacgatccgatcgtcgacatcgcgcgcaag
gccgacgtgagtcagccgacggtgatccgcttctgccgttcgctcggttgccagggcttg
tcggacttcaagctgaagctcgccaccggtttgaccggcacgattccggtcagccatagc
caggtgcatctcggcgataccgcgaccgatttcggcgcgaaggtgctcgacaacacggtg
tcggcgattctgcagttgcgcgagcatctgaacttcgagcatgtggagcgcgccatcgac
ctgctgaacggcgcgcggcgcatcgagttttacggactcggcaattcgaacatcgtcgcg
caggacgcgcactacaagttcttccgcttcggcattccgactattgcctacggcgacctg
tacatgcaggcggcgtcggcggcgctgctcggcaagggcgacgtgatcgtcgccgtgtcg
aagtcgggccgcgcgcccgaactgctgcgcgtgctggatgtggcgatgcaggccggcgcg
aaagtgatcgcgatcacgtcgagcaatacaccgttggccaaacgcgccacggtcgcgctc
gaaaccgatcacatcgaaattcgcgagtcgcagctctcgatgatttcgcggatcctgcat
ctcgtgatgatcgacattctcgcggtcggcgtggcaattcgccgcgcggcgccgagcgcc
gacgtcgcggaagccgtggccaaagtgcgtcagggcgccgacgacgacgccaccgccgtg
ctcgactggctcagccacggcgcggcttcatcggctcgcgactag

DBGET integrated database retrieval system