KEGG   Paraburkholderia phenoliruptrix: BUPH_05461Help
Entry
BUPH_05461        CDS       T02300                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
Enzymes [BR:bpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BUPH_05461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 MTS Methyltransf_11 Methyltransf_23 PrmA RrnaAD Methyltransf_12 Met_10 Ubie_methyltran Methyltransf_18 Methyltransf_32 ADH_zinc_N DUF938 Methyltransf_16 Methyltransf_24 Methyltransf_3 tRNA_U5-meth_tr UPF0146 Cons_hypoth95 Methyltransf_4 MetW Methyltransf_9 CMAS MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: AFT84887
UniProt: K0DJF6
Position
1:complement(877215..877868)
Genome map
AA seq 217 aa AA seqDB search
MNIEQARFNMIEQQIRPWEVLDQDVLNLLSIVKRENFVPAAYRELAFADFEVPLPAGQHM
LAPRVEARVLQELAVKKHESVLEIGAGSGYMAALLAHRAQHVLTVDIEPELAELAKTNLI
ANGVLNVEVATGDAARGWAAAAPYDVICVSGGLPVLPQDILEHLKIGGRLAAFVGTAPVM
KAQIITRIDEKQYRIADVFETYVEPLVNAVQPPRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgagcaagcgcgtttcaacatgatcgaacagcagatccgcccctgggaagtg
ctcgaccaggacgtgctgaatctgctgtcgatcgtcaagcgtgagaacttcgtccccgcc
gcgtaccgcgagctggctttcgccgacttcgaagtgccgctgccggccggccagcacatg
ctggcgccgcgcgtcgaggcgcgcgtgctgcaggaactggcggtgaagaagcacgaaagc
gtgctcgaaatcggcgccggctcgggttatatggcggcgttgctcgcgcatcgcgcgcaa
catgtgctgacggtagacatcgaaccggaactggcggaactggccaagaccaacctgatc
gccaacggcgtgctgaacgtggaagtcgccaccggcgacgccgcgcgcggctgggccgcc
gccgcaccgtatgacgtgatctgcgtgtcgggcggcctgcccgtgctgccgcaggacatt
ctggagcatctgaaaatcggcggccgtctggcggcgttcgtcggcacggcgccggtcatg
aaggcgcagatcatcacgcgcatcgacgaaaagcagtaccgcattgccgacgtgttcgaa
acctatgtcgagccgctcgtcaacgccgtgcagccgccgcgcttcaagttctga

DBGET integrated database retrieval system