KEGG   Burkholderia phenoliruptrix: BUPH_05523Help
Entry
BUPH_05523        CDS       T02300                                 

Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUPH_05523
   00030 Pentose phosphate pathway
    BUPH_05523
   00051 Fructose and mannose metabolism
    BUPH_05523
   00052 Galactose metabolism
    BUPH_05523
   00500 Starch and sucrose metabolism
    BUPH_05523
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_05523
  Nucleotide metabolism
   00230 Purine metabolism
    BUPH_05523
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BUPH_05523
Enzymes [BR:bpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BUPH_05523
    5.4.2.8  phosphomannomutase
     BUPH_05523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:784547..785941
Genome map
AA seq 464 aa AA seqDB search
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELIQA
LSDGLRAAGVDVVNVGMVPTPVGYFAASVPLQLEGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGSAIYGEQIQALHQRIVDEKFSEGSGTYVEYDIADDYLQRIASDVRLARPIKIVVDT
GNGVAGGLAPQLFRKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVDDP
SKLLNSLPNSHSTPELQLKLEEGENFELIARLQKNAQFTGADDVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVILAEKADAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaaatccattttcaaggcgtatgacattcgcggtgtgatcggcaagacgctc
gacgccgacgcagcgcgttcgatcggccgcgcgttcggcagcgaagtgcgtgcgcagggc
ggcgacgcggtggtggtcgcgcgcgacggccgtctgtcgggtccggagttgatccaggcc
ttgtccgacggcctgcgtgcggccggcgtcgacgtggtgaatgtcggcatggtgcctacg
cccgtcggttatttcgcggcaagcgtgccgttgcagctcgagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtgacgggtagtcataatccgccggattacaacggcttcaagatg
gtgctgcgcggctccgcgatttacggcgagcagattcaggcgctgcatcagcgcatcgtc
gacgaaaaattttctgagggcagcggcacgtatgtcgagtacgacattgccgacgactat
ctccagcgcatcgcaagcgacgtgaggctcgcgcgtcccatcaagatcgtggtggacacc
ggcaacggcgtcgcgggcggcctcgcgccccagctcttcaggaagcttggttgcgaactc
gtcgagctcttcacggagatcgacggcaacttcccgaaccatcacccggacccggcgcat
ccggaaaaccttcaggacgtgattcgcgcgctgaaggaaacggacgcggaaatcggcttc
gcattcgacggcgacggcgaccgcctcggcgtcgtcacgaaagacggccagatcatttat
ccggaccgccagctcatgctcttcgccgaagaagtgctgtcgcgcaacaagggcgcgcag
atcatttacgacgtgaagtgcacgcgcaatctcgcgaagtgggtgaaagacaagggcggc
gagccgctcatgtggaagacgggccactcgctagtgaaggcgaagctgcgcgaaaccggc
gcgccgctcgcgggcgaaatgagcggccacgtgttcttcaaggaccgctggtacggtttc
gacgacggtctctacaccggcgcgcgtctgctcgaaatcctcacgcgcgtagatgacccg
agcaagctgctgaactcgctgcccaattcccactccacgcccgagctgcaactgaagctg
gaagaaggcgagaacttcgaactcatcgcacgtctgcagaaaaacgcgcaattcaccggc
gcggacgatgtcgtgaccatcgacggtctgcgcgtcgagtacccggacggcttcggcctc
gcgcgttcgtcgaacaccacgccggtcgtggtcatgcgtttcgaggccgacaacgacgcg
gcgctcaagcgcatccaggaagacttccgccgcgtgattctcgcggagaaggcggacgcg
aagctgccgttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system