KEGG   Burkholderia phenoliruptrix: BUPH_05760Help
Entry
BUPH_05760        CDS       T02300                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BUPH_05760
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BUPH_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1998439..1999632)
Genome map
AA seq 397 aa AA seqDB search
MRFGINRKQGLAVALGLTLGLAASAGSARLAKAAQPAAAPGACGDWSAYRTFVERFVQAD
GRVIDYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLNWTRANLAANQFDPQNLRLPAW
LWGRKADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEPAYTQLGQALAARIVRDETTSL
PGVGPMLLPGPQGFRDGGVTRLNPSYLPLPVLRALAHELPNGPWAKLAESAYKLVKTTSP
QGFAPDWAAWQNGQFVVDPKNSDIGSYDAIRVYLWAGLASPADPLAKPWLAALGGMRAKV
EQNGYPPEKVSSTNGTASGEGPLSYWGALAPYFKALGDAHGLGLARTHLAALDAGVPGRE
PVYYDRVLGLFGTGFVDGRYRFDESGRLVPGWRNACD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttggaatcaacagaaaacagggcctcgcggtggcgctcggcctgacgctcgga
ctcgcggcatcggcgggatcggcccggctcgcgaaggccgcacagccggccgccgcgccc
ggcgcatgcggcgactggagcgcctatcgcacgttcgtcgaacgcttcgtgcaggccgac
ggccgcgtgatcgactactcgacgccgactcagcagaccacgtcggaaggccagtcgtac
ggcctcttctttgcgctcgtcgcgaacgaccgcgcgaccttcgaccgcctgctgaactgg
acgcgcgccaacctcgcggccaatcagttcgatccgcagaacctgcgcctaccggcgtgg
ctatggggcagaaaggcggacggctcgtatggcgtgctcgatcccaattcggcatccgac
tccgacctgtggatcgcctacgacctgctgcaagccggacgcctgtggcacgaacccgcc
tatacgcagctcggtcaggcgctcgcggcgcgcattgtccgcgacgagacgacgagcctg
ccgggcgtcggtccgatgctgctgccggggccgcaaggtttcagggacggcggcgtcacg
cgtctgaatccgagctatctgccgctgcccgtgctgcgcgcgctcgcccacgaactgccg
aacggcccgtgggccaagctcgcggaaagcgcctacaagctcgtcaaaacgacctcgccg
caaggcttcgcgccggactgggccgcgtggcagaacggccagttcgtggtcgatccgaag
aacagcgacatcggcagctacgacgcgatccgcgtctacctgtgggccggtctcgcctcg
cccgccgatccgctcgcgaagccgtggctcgccgcgctcggcggcatgcgcgcgaaagtc
gagcaaaacggctatccgccggaaaaggtgtcgtcgaccaacggcacggcaagcggcgaa
ggcccgctcagctactggggcgcgctcgcgccgtacttcaaggcgctcggcgacgcgcac
ggcctcggcctcgcgcgcacgcatctggccgcgctcgacgccggcgtgccgggccgcgaa
ccggtgtactacgacagggtgctgggcttgttcggcacgggtttcgtcgacggacgctat
cgctttgacgaaagcggccgtctcgtgccgggctggagaaacgcatgcgattga

DBGET integrated database retrieval system