KEGG   Paraburkholderia phenoliruptrix: BUPH_05760Help
Entry
BUPH_05760        CDS       T02300                                 

Definition
(GenBank) endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bpx  Paraburkholderia phenoliruptrix
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1998439..1999632)
Genome map
AA seq 397 aa AA seqDB search
MRFGINRKQGLAVALGLTLGLAASAGSARLAKAAQPAAAPGACGDWSAYRTFVERFVQAD
GRVIDYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLNWTRANLAANQFDPQNLRLPAW
LWGRKADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEPAYTQLGQALAARIVRDETTSL
PGVGPMLLPGPQGFRDGGVTRLNPSYLPLPVLRALAHELPNGPWAKLAESAYKLVKTTSP
QGFAPDWAAWQNGQFVVDPKNSDIGSYDAIRVYLWAGLASPADPLAKPWLAALGGMRAKV
EQNGYPPEKVSSTNGTASGEGPLSYWGALAPYFKALGDAHGLGLARTHLAALDAGVPGRE
PVYYDRVLGLFGTGFVDGRYRFDESGRLVPGWRNACD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttggaatcaacagaaaacagggcctcgcggtggcgctcggcctgacgctcgga
ctcgcggcatcggcgggatcggcccggctcgcgaaggccgcacagccggccgccgcgccc
ggcgcatgcggcgactggagcgcctatcgcacgttcgtcgaacgcttcgtgcaggccgac
ggccgcgtgatcgactactcgacgccgactcagcagaccacgtcggaaggccagtcgtac
ggcctcttctttgcgctcgtcgcgaacgaccgcgcgaccttcgaccgcctgctgaactgg
acgcgcgccaacctcgcggccaatcagttcgatccgcagaacctgcgcctaccggcgtgg
ctatggggcagaaaggcggacggctcgtatggcgtgctcgatcccaattcggcatccgac
tccgacctgtggatcgcctacgacctgctgcaagccggacgcctgtggcacgaacccgcc
tatacgcagctcggtcaggcgctcgcggcgcgcattgtccgcgacgagacgacgagcctg
ccgggcgtcggtccgatgctgctgccggggccgcaaggtttcagggacggcggcgtcacg
cgtctgaatccgagctatctgccgctgcccgtgctgcgcgcgctcgcccacgaactgccg
aacggcccgtgggccaagctcgcggaaagcgcctacaagctcgtcaaaacgacctcgccg
caaggcttcgcgccggactgggccgcgtggcagaacggccagttcgtggtcgatccgaag
aacagcgacatcggcagctacgacgcgatccgcgtctacctgtgggccggtctcgcctcg
cccgccgatccgctcgcgaagccgtggctcgccgcgctcggcggcatgcgcgcgaaagtc
gagcaaaacggctatccgccggaaaaggtgtcgtcgaccaacggcacggcaagcggcgaa
ggcccgctcagctactggggcgcgctcgcgccgtacttcaaggcgctcggcgacgcgcac
ggcctcggcctcgcgcgcacgcatctggccgcgctcgacgccggcgtgccgggccgcgaa
ccggtgtactacgacagggtgctgggcttgttcggcacgggtttcgtcgacggacgctat
cgctttgacgaaagcggccgtctcgtgccgggctggagaaacgcatgcgattga

DBGET integrated database retrieval system