KEGG   Burkholderia phenoliruptrix: BUPH_05988Help
Entry
BUPH_05988        CDS       T02300                                 

Definition
magnesium chelatase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BUPH_05988
Enzymes [BR:bpx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BUPH_05988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2508643..2509707
Genome map
AA seq 354 aa AA seqDB search
MNAVTESAHQGSAQKPAFPFAALIGQSALQQALLLAAIDPGIGGVLVSGPRGTAKSTAAR
ALAELLPHGQLVNLPLGASEDRLIGTLDIETVLRDGSVRFSPGLLAKAHRGVLYVDEVNL
LPDALVDALLDAAASGVNTVERDGVSHSHEASFVLIGTMNPEEGELRPQLIDRFGLMVEL
QNCFEPRVREQIVKARLAFELDPAGFRAGYAQQQAQYVERIRAAREVLPQLSFDDALHAH
VSALCIDAAVDGLRADLVMLRAARALAAWDLADAVTTQHVDSVAEAVLVHRRRARGATPG
SSEAGPRDSSADSAEPGPLQQASGGSDSDWGYLPAQPVGTTQVKGVVPLPLKKR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcacggaaagtgctcatcaaggctcggcgcaaaagcccgcttttccgttt
gccgcgttgatcggacaaagcgcgttgcagcaggcgttgctgctcgcggcgatcgatccg
ggaatcggcggcgtgctggtgagcggaccgcgcggaacggcgaaatcaacggcggcgcgt
gcgcttgccgagttgcttccgcacgggcagctcgtgaacctgccgcttggcgcaagcgag
gatcgcctgatcggcacgctcgatatcgaaaccgtgctgcgcgacggctccgtgcgcttc
tcgcccgggttgcttgcgaaagcgcatcgcggcgtgctgtatgtggacgaagtcaacctg
ctgcccgatgcgctcgtcgatgccttgctcgatgcggcggcgagcggtgtgaacaccgtt
gagcgcgatggcgtatcgcatagtcacgaggcgagcttcgtgctgatcggtacgatgaat
ccggaagaaggcgagttgcggccgcaattgatcgaccgtttcggcttgatggtggagttg
cagaactgcttcgaaccgcgcgtgcgcgagcagatcgtgaaagcgcggctcgcattcgag
ctcgatcctgccggctttcgcgccggttatgcgcagcaacaggcgcagtacgtggagcgg
attcgtgcggcccgcgaggtattgccgcaactttccttcgacgacgcactacacgcgcac
gtgagcgcattgtgtatcgacgccgccgtggacggcttgcgcgccgacctcgtgatgctt
cgcgcggcacgtgctctggccgcgtgggatcttgcggacgcggtcacgacgcagcatgtc
gatagcgttgcggaggcggtgcttgtgcacaggcggcgcgcgcggggcgcgacccctggc
agcagcgaggcggggccacgcgattcgtcggcggattccgctgagcccggaccattgcag
caagctagcgggggcagtgacagcgattggggttatttgcccgcgcagccggttgggacc
acacaggtcaaaggcgtcgtaccgcttccactaaaaaaacgctga

DBGET integrated database retrieval system