KEGG   Burkholderia phenoliruptrix: BUPH_06176Help
Entry
BUPH_06176        CDS       T02300                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bpx  Burkholderia phenoliruptrix
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BUPH_06176
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BUPH_06176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2270307..2273717)
Genome map
AA seq 1136 aa AA seqDB search
MNRLSSSVTAMKSHYEVVVIGSGYGGAIAASRMARAGRSVCVLERGREFMAGEYPRTPFQ
GAEQIQYNTPAAQIGSPLALLEVHVNDDVNAVVGCGLGGTSLINANVALKLDPRLWDDAR
WPAALRADEAGRDTGYQRAWDMLQPSPVPARFRELPKLLALARSAEALGMAERFSTPPIT
VTFEDRTNAAGVAQKACTGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGAAVHSVT
RNAATQTWQVGYQLVRLGRESYDAPDLFVSADIVIVSAGTIGSTALLLRSRNEGLSVSGM
LGERFTGNGDVLAFAYNTDDTINGVGWGAHVEGDIPPVGPTITGLIDHRNTVDVKDGFVI
EEGSLAGPVGAALVGMLGAAAPLTGVDVSGPRTADRQLAYDARVVESFLHGPYRGALNHT
QSYLVMAHDDESGQISVNDKGRPRIAWENAGKQPIYETVEETLKNATVPLGGKYLRDPIS
NDIFGNRTVTVHPLGGCPMGEDAEHGVVDHMGRVFSGMAGTAVHDGLYVMDGAVMPMSLG
VNPLWTISALAERNCALLAASRGWTIDYDSKGTAAAPPAQKIGLRFTETMVGHYTPTGAS
KDAASPMAFTLTVESDDLADMLSDPNHLARTAGTLTCPALSAQPMTIADGTFNLFVADPQ
DVDERNMNYRMTLNSAEGKTYYLSGQKIITRTSPLELWEQTNTLYARVFDTPHADAAPLG
SATLIITPENFLKQQRTLEVTNAPDLATRLEWTLKFGKFFAGVLFSEYGGIAAPLQYYDP
DAKPRLKRALRAPAPQVFFFDTPDGTRLRLTRYVDPARKNARPVLLIHGSGVSSRIYSTD
LIDTNLVEYLCAAGYDVWLVDLRVSIEMPSVLVPTNVDKVALEDIPAAVAKIREVTGATA
IQALGHCMGGLALSMSLMAGLEGVRSAVISQVAVHPVPPTLGRIKAGLHIPDIMQHLGVT
DLNAYTQDEKWPHNLFDEALRLYPVDHDEGCGNPICHRATFMYGLLYEHAQVSETLHSNL
QELLGVHDVGVFRHLAAMVRAGNVVDADGNDVYLRGGHGMKGLAGMRIPIGFIHGDRNET
YVPKSTALTYQMLVDAFPEQPYERYLIPGYGHIDCIFGKNAAVDVYPTIARYLNAH
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagttccgtgacggcgatgaaatcgcattatgaagtggtggtgatc
ggttcaggttatggcggcgccattgcggcgagccgcatggcccgcgcgggccgcagcgtc
tgcgtgctggagcgcgggcgcgagttcatggcaggcgaatacccgcgcaccccgtttcaa
ggcgccgagcagatccagtacaacacgcccgccgcgcagatcggctcgccgctcgcgctg
ctcgaagtgcatgtgaacgacgacgtcaacgcggtggtcggctgcggcctcggcggcacc
tcgctgatcaacgcgaacgtcgcgttgaagctggatccgcgcctgtgggacgacgcgcgc
tggcccgctgcgctacgtgcggacgaggccggacgcgacaccggttatcagcgcgcatgg
gacatgttgcaaccctcgccggtaccggcccgattccgcgaattgcccaagctgctcgcg
ctcgcacgatccgccgaggcgctcggcatggcggagcgcttcagcacgccgcccatcacc
gtcactttcgaggatcgcacaaacgcggccggcgtcgcgcagaaagcctgcaccggatgc
ggcgactgcaactcgggctgcaactacgacgcaaagaattcgacgcacatgaactatctg
cccgacgccgttgcgcacggcgcgcagattttcacgggagccgcggtgcattcggtgacg
cgcaatgccgctacccaaacgtggcaagtcggctatcagctggtgcgccttggccgcgag
agctacgacgcgccggacctgttcgtgagcgcggacatcgtgatcgtatctgcgggaacg
atcggctcgaccgccttgctgctgcgttcgcgcaatgaaggcctgagcgtgtcgggcatg
ctcggcgagcgcttcaccggcaacggcgacgtgctcgccttcgcgtacaacaccgacgac
accatcaacggcgtcggctggggcgcgcatgtggaaggcgatatcccgccggtggggcca
accatcacggggttgatcgaccatcgcaataccgtcgacgtcaaagacggcttcgtgatc
gaagaagggtcgctcgccgggccggtcggcgccgcgctcgtgggcatgttgggcgccgct
gcgccgctcaccggcgtggacgtgtcgggaccgcgcacggcggaccggcagctcgcctac
gacgcccgcgtcgtcgaaagcttcctgcacggtccgtaccgcggcgcgctcaatcacacg
caaagctacctcgtgatggcgcacgacgacgaaagcggtcagatcagcgtcaacgacaaa
ggacggccgcgcatcgcatgggagaacgccggcaagcagccgatctacgaaacggttgaa
gagacgctgaagaatgcgacggtgccgctcggcggcaaatacctgcgcgatcccatttcc
aacgacatcttcggcaaccgcaccgtgaccgtgcatccgctcggcggctgtccgatgggc
gaagacgccgaacatggcgtggtcgatcatatgggccgcgttttcagcggcatggccggc
acggccgtgcacgacggcctgtacgtgatggacggcgcagtcatgccgatgtcgctcggc
gtcaacccgctgtggacgatctcagccctcgccgagcgcaattgcgcgctcctcgccgcg
tcgcgaggctggacgatcgactacgactcgaagggcaccgccgccgcgccgcccgcgcaa
aaaatcggcctgcgcttcaccgaaacgatggtcgggcattacacgccgaccggcgcaagc
aaggacgcggcaagcccgatggcgttcacgctgaccgtcgagtccgacgacctcgccgat
atgctcagtgatccgaaccatctggcgcggactgccggcacactcacctgccccgccctg
tccgcgcagccgatgacgatcgccgacggcaccttcaatctgttcgtggccgaccctcag
gatgtcgacgagcgcaacatgaactaccggatgacgctcaactcagcggaagggaaaacc
tactatctgagcggtcagaagatcatcacgcgcacgtcgccgctcgaactgtgggagcaa
accaacacgctttatgcgcgcgttttcgacacgccacacgccgacgcggcgccgctcggc
agcgcgacgctgatcatcacgccggaaaatttcctgaagcagcagcgcacgctggaagtc
acgaacgcgccagatctggcaacgcgtctcgaatggacgctcaaattcggcaagttcttt
gcgggcgtgctgttcagcgagtacggcggcattgccgcgcctttgcagtactacgatccc
gacgccaagccgcgcctgaagcgagccttgcgtgcaccggcgccgcaggtgttcttcttc
gacacgcccgacggcacgcgtttgcggcttacgcgctatgtcgatcctgcgcgcaagaac
gcacgccccgtgttgctgattcacggctcgggcgtgtcgagccgcatctactccaccgac
ctgatcgacaccaacctcgtcgaatatctgtgcgccgcgggctacgacgtctggctcgtc
gatctgcgcgtgagcatcgaaatgccgagcgtgctggtgccgaccaacgtcgataaagtc
gcgctcgaggacattcccgcagccgtcgcgaagattcgcgaagtgaccggcgctaccgct
atccaggcgctcggccattgcatgggcggcctcgcgttgagcatgtcgttgatggcggga
ctggaaggcgtacgctcggcggtgatctcgcaggtcgccgtgcatccggtgccgcccacg
ctcggccgtatcaaggcgggcctgcacattcccgacatcatgcagcacctcggcgtgacc
gacctcaacgcttacacacaggacgaaaagtggccgcacaatctcttcgacgaggcgctg
cggctctaccctgtcgaccacgacgagggctgcggcaatccgatctgtcatcgcgcgacg
ttcatgtacgggctgctctatgagcatgctcaggtgagcgaaacactgcattcgaacctg
caggaactgctcggtgtgcatgacgtcggcgtgttcaggcatctggccgcgatggtgcgt
gcgggcaacgtcgtcgacgccgacggaaacgatgtctatctgcgcggagggcatggcatg
aaaggccttgccggcatgcgcattcccattggcttcattcacggcgaccgcaacgaaacc
tatgtgccgaagagcaccgcgctcacctatcaaatgctcgtcgacgcctttcccgagcaa
ccttacgagcgctatctgattccgggctatggacatatcgactgcatcttcggcaagaat
gcggcggtcgatgtctatccgactatcgcgcgctatctgaacgcgcattga

DBGET integrated database retrieval system