KEGG   Paraburkholderia phenoliruptrix: BUPH_06219Help
Entry
BUPH_06219        CDS       T02300                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00071  Fatty acid degradation
bpx00280  Valine, leucine and isoleucine degradation
bpx00281  Geraniol degradation
bpx00310  Lysine degradation
bpx00360  Phenylalanine metabolism
bpx00362  Benzoate degradation
bpx00380  Tryptophan metabolism
bpx00410  beta-Alanine metabolism
bpx00627  Aminobenzoate degradation
bpx00640  Propanoate metabolism
bpx00650  Butanoate metabolism
bpx00903  Limonene and pinene degradation
bpx00930  Caprolactam degradation
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01212  Fatty acid metabolism
Module
bpx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BUPH_06219
   00650 Butanoate metabolism
    BUPH_06219
  Lipid metabolism
   00071 Fatty acid degradation
    BUPH_06219
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUPH_06219
   00310 Lysine degradation
    BUPH_06219
   00360 Phenylalanine metabolism
    BUPH_06219
   00380 Tryptophan metabolism
    BUPH_06219
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BUPH_06219
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BUPH_06219
   00281 Geraniol degradation
    BUPH_06219
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUPH_06219
   00627 Aminobenzoate degradation
    BUPH_06219
   00930 Caprolactam degradation
    BUPH_06219
Enzymes [BR:bpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BUPH_06219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFT87221
UniProt: K0DM74
Position
1:complement(3675465..3676241)
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALRAFDADDGIGAIVVAGSEKA
FAAGADIGMMSTYSYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDMI
FAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDATEAERAGLVSRV
IPAASLIEESIAAAATIAEFPLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacattctggtcgaaacgcgggggcgggtcggtttggtcacattgaac
cgcccgaaggcattgaacgcgcttaacgatgcgttgatggacgaactgggggcggcgctg
cgcgcgttcgatgccgacgacggcatcggcgccattgtggtggcgggcagtgagaaggcg
ttcgccgccggtgccgacatcggcatgatgtcgacctattcctatatggacgtctacaag
ggcgactacatcacgcgcaactgggagacggttcgctcgatccgcaagccgatcattgca
gcggtggcgggctttgcgctgggcggtggctgcgaactcgcgatgatgtgcgacatgatt
ttcgccgcggacactgcgaagttcggtcagccggaaatcaagctcggcatcatgccgggc
gccggtggcacgcagcgcttgccgcgcgcggtgtcgaaggccaaggcgatggacctttgc
ctgacggcgcgcttcatggacgccacggaagccgagcgcgccggattggtgtcgcgggtc
attcccgctgcgtcgttgatcgaggagtcgatcgccgcggccgctacgatcgcggagttc
ccgctgccggcagtcatgatggtgaaggagtcggtgaatcgggcgtacgaaacgacgctt
gcggagggcgtgcatttcgagcgtcggctcttccattcgctgttcgcgacggaggaccag
aaagaagggatggcggcgttcgtggagaagcgcaagccagttttcaaacaccgttaa

DBGET integrated database retrieval system