KEGG   Burkholderia phenoliruptrix: BUPH_06238Help
Entry
BUPH_06238        CDS       T02300                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpx  Burkholderia phenoliruptrix
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3694862..3695605)
Genome map
AA seq 247 aa AA seqDB search
MNQEFSMKRTFRMAAAVLAIAAVTFGCSAQADQSTDKLKATLQSRLADVTIKSVTKSPIA
GLYEVNLGNQIVYSDANGDYLLLGDMVDTKTRKNLTDARLSETNRIDFASLPFANAVKVV
KGNGSRKIAVFSDPNCPYCKQLETTLKSIDNVTVYTFLYPVLSPDSTAKSKSIWCSTDRA
KAWESWMQDHQAPTAAGTCDTAAIDKNLALGHAMNVEGTPTVFLADGRRLPGAVPADRLD
KEMAAVH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccaggaattcagcatgaaaagaactttccgcatggccgcagccgtgctcgcgatc
gccgccgtcacgttcggctgctccgcgcaggccgaccagtccaccgacaagctcaaggcc
acgctgcaaagccgccttgccgacgtgaccatcaagagtgtgaccaagtcgccgatcgcc
ggcctttacgaagtgaacctcggcaaccagatcgtctatagcgacgccaacggcgactat
ctgctgctcggcgacatggtcgacaccaagacgcgcaagaatctgacggacgcgcgtctg
tcggaaaccaaccgtatcgatttcgcgagcctgccgtttgcaaatgcggtcaaggtcgtg
aagggcaacggctcgcgcaagatcgccgtgttctccgatccgaactgcccgtactgcaag
cagctcgaaaccacgctgaagtcgatcgacaacgtgacggtctataccttcctgtacccg
gtgttgtcgccggattccactgccaagtcgaagtccatctggtgctcgacggaccgcgcg
aaagcctgggagtcgtggatgcaggatcatcaggcgcccacggccgccggcacttgcgac
accgccgcgatcgacaagaacctcgcgctcggccacgcgatgaacgtcgaaggcacgccg
accgtatttctcgccgacggccgccgcctgcccggcgccgtgccggccgaccggctcgac
aaggaaatggccgcggtgcattga

DBGET integrated database retrieval system