KEGG   Paraburkholderia phenoliruptrix: BUPH_06289Help
Entry
BUPH_06289        CDS       T02300                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00340  Histidine metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BUPH_06289
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BUPH_06289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: AFT87291
UniProt: K0DMG5
Position
1:complement(3745323..3746645)
Genome map
AA seq 440 aa AA seqDB search
MSIKIRKLDSTAPDFQKSLHAVLAFEASEDEAIERSVAQILNDVKARGDAAVLEYTNRFD
RLDAPSVGALELPISELEAALEGLEPKRRASLEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRAGIYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGVKNPLV
LAAALLGGVDRVFTIGGAQAVGALAYGTETVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDDAFIGRVQDAINELLPTM
PRRDVIQASLEGRGALVKVRDMAEACAIANDIAPEHLEISALEPHQWGQLIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSVIEVSAEGAQTLGEIAAELA
YGEGLQAHARSAEYRMRQGG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaagattcgcaaactcgattccaccgctcccgacttccagaagtcgctgcac
gcggtgctcgcgttcgaggcgagcgaagacgaagcaatcgagcgctcggtcgcgcagatc
ctgaacgacgtgaaggcgcgcggcgacgcggcggtgctggaatacacgaaccgcttcgac
cggctggacgcgccgagcgtcggcgcgctggagttgccgatttcggagctggaagcggcg
ctggaaggcctcgagccgaagcggcgcgcgtcgctcgaagccgcggcggcgcgcgtgcgc
ggctatcacgagaaacagaagatcgagtgcggcagtcacagttggcaatacacggaagcc
gacggcaccgtgctcggccagaaggtcacgccgctcgatcgggcgggcatctacgtgccg
ggcggcaaggcggcgtatccgtcgtcggtgttgatgaatgcgattccggctcgcgtggcc
ggcgtgcgcgaaatcgtcatggtcgtgcccacgcctgacggcgtgaagaatccgctggtg
ctggcggccgcactgctcggcggcgtggatcgcgtgttcaccattggcggcgcgcaggct
gtcggcgcgctcgcgtacggcaccgagaccgtgccggctgtcgacaagatctgcggcccg
ggcaacgcgtatgtggcgtcggccaagcgccgcgtgttcggcacggtcggcatcgacatg
attgcggggccgtcggaaattctcgtgctctgcgacggcacgaccgatccgcgctgggtc
gccatggacctgttctcgcaagccgagcacgacgaactcgcgcagtccattttgctatgt
ccggacgacgcgttcattggccgcgtgcaggatgcgatcaacgaactgctgcccaccatg
ccgcgccgcgatgtgattcaggcgtcgctcgaagggcgcggcgcgctcgtcaaggtgcgc
gacatggctgaagcctgcgcgatcgccaacgacatcgcgccggagcaccttgagatttcg
gcgctggagccgcatcagtggggccagctgatccgccacgcgggtgccatcttcctcggc
cgctacacgagcgagagtctcggcgactactgcgcggggccgaaccacgtgctgcctacg
tcgcgcacggcacggttctcgtcgccgctcggcgtctatgatttcttcaagcgctcgagc
gtgatcgaagtgagcgcggaaggcgcgcagacgctcggcgaaatcgccgccgaactggct
tacggcgaaggtttgcaggcgcacgctcgcagcgcggaataccggatgcggcaaggcggc
tga

DBGET integrated database retrieval system