KEGG   Paraburkholderia phenoliruptrix: BUPH_08124Help
Entry
BUPH_08124        CDS       T02300                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BUPH_08124
Enzymes [BR:bpx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BUPH_08124
Transporters [BR:bpx02000]
 Other Transporters
  Pores ion channels [TC:1]
   BUPH_08124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AFT84843
UniProt: K0DLZ5
Position
1:804358..805011
Genome map
AA seq 217 aa AA seqDB search
MGGAMPTTEMVKLYGAAWSVYVRIVRLALQEKQVKYELVEVDVFAETGVPQEHLTRHPFG
RIPAFEHGGFHLYETGAIVRYIDDAFPGCELQPIDPRARAKVNQIVGILDAYAYRTLVWD
IYVERVVSVREGRLADERKIAAALPRAAVCLSELNRLADDQEFLIGDDVTFADLYAAPMF
AYFMQTPEAVSLTEGHDKLICWWQRFSARDSMSRTCP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ctgggcggagctatgccgacaaccgaaatggtgaaactatacggagccgcctggagtgta
tatgtgcggattgtccggcttgcgctccaagagaagcaggtcaaatatgaattggttgaa
gtggacgtcttcgcagaaactggagttccgcaggagcatttgacgcggcacccgttcggc
cgcattccagccttcgagcacggagggttccatctttacgagacaggcgcgattgttcgc
tatatcgacgacgcttttcccggatgcgaactgcaaccgatcgatccaagagcccgcgcg
aaggtcaaccagatcgttgggatactggacgcttatgcatatcgaacgctcgtttgggac
atatacgttgaacgcgtcgtttcagtccgcgaaggccggttagccgatgagcggaagatc
gctgcggcgctaccacgtgccgcggtgtgtctatctgagctgaaccggttggccgacgat
caagagtttctgattggcgatgacgtgacgttcgccgatctgtacgccgcgccgatgttt
gcatacttcatgcagacacctgaagctgtttccttaacggaaggacacgacaaattaatc
tgctggtggcagcgattcagcgctcgcgacagcatgtcacggacatgtccgtga

DBGET integrated database retrieval system