KEGG   Paraburkholderia phenoliruptrix: BUPH_08466Help
Entry
BUPH_08466        CDS       T02300                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00040  Pentose and glucuronate interconversions
bpx00052  Galactose metabolism
bpx00500  Starch and sucrose metabolism
bpx00520  Amino sugar and nucleotide sugar metabolism
bpx01100  Metabolic pathways
bpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BUPH_08466
   00052 Galactose metabolism
    BUPH_08466
   00500 Starch and sucrose metabolism
    BUPH_08466
   00520 Amino sugar and nucleotide sugar metabolism
    BUPH_08466
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BUPH_08466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AFT90101
UniProt: K0DV30
Position
pSYMBR3459:complement(172435..173340)
Genome map
AA seq 301 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIDSGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLSLVRSIKPRHIDCFYVRQAEALGLGHAVLCAEK
LVGDSPFVVMLADDLLHGEPPVLRQMIRVFDHYHTSVIGVEEIDRQMSGSYGVIDGKQWE
DNIFKLSGIVEKPIPAVAPSNYGVVGRYILKPKIFEHLHALKPGSGGELQLTDALQSLLN
DEQVLAYKYDGNRFDCGSKLGYLKATVEFALRHPEVASDFDQYLRSRVSTPDQSFTDHID
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagttacaaaggccgtatttccggttgccggtctcggtacccgattcctacct
gcgacaaaggcaagccccaaagagatgctgcccatcgtagacaagcctttgatccagtac
gctgtcgaagaggccatcgattcgggcattacggagatgatctttgtcactggccggagc
aagcgggctatcgaagatcactttgacaagtcatacgagatcgaggccgagcttgaggca
cgcggtaaggataagctgctttcgctcgttagaagtatcaagccccgtcacatcgattgc
ttttacgtccgacaggcggaggcgcttggcctcggccacgccgtgttatgtgcggagaag
ttggtcggcgatagtcccttcgtggtgatgttagccgacgatctcctgcacggcgaacca
cctgttctgcgacagatgattcgcgtatttgatcactaccacacttcggtaattggagtc
gaagagatcgatcgccagatgtctggttcatacggcgtaatcgacggaaaacaatgggaa
gacaatatctttaaattgtctggaattgtcgaaaaacccattcccgccgttgctccgtcg
aactatggtgtggttggtcgctatattctgaaacccaagatcttcgagcatttgcacgca
ttgaagccgggttcaggtggagaactccagctcacagacgcgttgcagagcctgcttaat
gatgagcaggtccttgcatataaatacgacggaaatcgttttgattgtggtagcaagcta
ggatacttgaaagcaacagtggaattcgcgctacgtcacccagaggttgcgagtgatttc
gaccagtatttaaggtctcgcgtcagtacgccagatcaatcattcacagatcacattgat
tcttaa

DBGET integrated database retrieval system