KEGG   Burkholderia phytofirmans: Bphyt_0073Help
Entry
Bphyt_0073        CDS       T00765                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bpy  Burkholderia phytofirmans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bphyt_0073
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bphyt_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:91180..92604
Genome map
AA seq 474 aa AA seqDB search
MDTSLDDRPAMAAAARQDGNGPRVIVIGSGIAGLTAAYRLGQAGMHVTVLEAAETVGGRM
GDRREGDIVFNSGARLVYPFGGAFNRLVADLALGDALVPLRRLSARCVTTKGDHLIELMP
TVRSLATPGLHLGERVAMVRHALRMRSQRDRVDPDWAISALDVDPEADRLNLADYIRREI
GPNAMSYLVEPVFRATRSFNPDALSTLFYRTTVPHLIGEDTVHTLKGGMGQVCRTLAGLL
DVRTGTRVTSVEHQRDGDELRLRVTLANGDALTADHVVCAVQGSLARELIRTPQAIERQM
LANVHYNALGVVHYGFAKSLPAQMQFASRDVGSRIATFQQTPAAPDQGRPLTQVYCQLAP
EAVDEAIRRGCTGELDVLLREELRARIPDFDRQVVAVVNQWIPRMLPLFAPGYGGRLRAF
WRWQEAPAQASGRPVVYCGDWTSQALLTGACASGERAARIVLARSQVVSGRAQS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggacacatctctggatgatcgaccggcgatggcggcggcagcgcgccaggacggcaat
ggcccccgcgtgattgtgatcggttcgggaattgcggggctcacagctgcctatcggctt
gggcaggcgggcatgcatgtaacggtactggaggccgcggaaacggttggcggtcgcatg
ggagaccggcgcgaaggcgatatcgttttcaacagcggcgcgcgcctcgtctacccgttc
ggcggtgcgttcaatcgtctggtcgccgacctcgcacttggcgatgcgctcgttccacta
cgccgtctgagcgcgcgctgtgtgacaacgaaaggggaccatctgatcgagttgatgccg
actgtacgctcgctggcgacgccggggttgcatctaggggagcgggtcgcgatggtgcgg
catgcgttacggatgcgttcgcagcgcgaccgcgttgatccggactgggcgatcagtgcg
cttgatgtcgacccggaggccgaccggctgaacctcgccgattacattcgcagggagatc
ggtccaaatgcgatgtcatacctggttgaaccggtgtttcgcgcgacgcgcagcttcaat
cctgatgcgttatcaaccctgttctaccgcaccaccgtgccgcatctgatcggcgaggat
acggtccacacccttaaaggtggtatgggacaggtatgccggacacttgccgggttgctg
gacgtgcggaccggaacgcgggtgacttccgtcgagcaccagcgcgatggcgatgagctt
cgtctcagggtcacgcttgcgaacggcgacgccttgactgccgatcacgtggtctgcgcg
gtccagggctcactcgcgcgggaattgatccgcacgccacaggctatagagcgccagatg
ctggccaatgtgcactacaacgcccttggtgttgtccactatggattcgcaaagtccctc
ccagcgcagatgcaattcgcttcgcgcgatgtcggaagccgtatcgcaacgtttcaacag
acgccggctgcgcccgatcaagggcgcccactcacgcaggtgtattgccagctggcgcca
gaggcagtggacgaagcaatcaggcgcggctgcaccggcgaacttgacgtgttgctgcgc
gaagagttacgtgcccgcattcccgacttcgaccggcaggtggtcgcggtcgtcaatcag
tggataccccggatgctgcctttgttcgccccggggtacggggggcgcctgcgcgccttc
tggcgttggcaggaggcgcctgcgcaggcctccgggcggcctgtcgtgtattgcggggac
tggacatcgcaggcgctgctcaccggcgcgtgtgcgagcggtgagcgggctgccagaatt
gtgctggcccggtcacaggtagtgtccggtcgcgcgcaaagttag

DBGET integrated database retrieval system