KEGG   Burkholderia phytofirmans: Bphyt_0589Help
Entry
Bphyt_0589        CDS       T00765                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bpy  Burkholderia phytofirmans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Bphyt_0589
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Bphyt_0589
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Bphyt_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:640315..641145
Genome map
AA seq 276 aa AA seqDB search
MPELPEVEVTRRGIEPYVSGRKVERVDVRTPALRWPIPADLAKTLRGHVVRKVERRGKYL
LFEIDAGWFIVHLGMTGTLRVLRHVPHPPAAAKHDHIDWIFDEFILRYRDPRRFGAVLWH
PREAGDVLEHPLLASLGVEPFSPAFSGALMHRLTRGRKVSVKQALLAGEIVVGVGNIYAS
ESLFRAGIRPTTAAGRVSLVRYELLADAVRVTLAAAIEKGGSTLRDFVGSNGESGYFQLD
YFVYDRAGLPCRVCGTPIKQIVQGQRSTYFCPTCQR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttgccagaagttgaggttacccgacggggaatcgaaccgtatgtgtccggg
cgcaaggttgagcgcgtggatgtgcgtacgcccgcattgcgctggccgattccggccgac
cttgcgaaaaccttgcgcggccacgtggtgcgcaaggtcgagcggcgcggcaagtatctg
ctgttcgaaatcgacgcgggctggttcatcgtgcatcttggcatgactgggacgctgcgg
gtgctgcgccacgtgccgcatccgccggccgcggcgaaacacgatcacatcgactggatc
ttcgacgagttcattttgcgctatcgcgacccgcggcgcttcggcgcggtgctgtggcat
ccgcgcgaagccggcgacgtgctcgagcatccgctgctcgcgagtctcggcgtcgaaccg
ttttcgcccgcgttttccggcgcgctaatgcaccggctcacgcgcgggcgcaaagtctcg
gtgaagcaggcgctgctggcgggtgaaatcgtggtgggcgtgggcaatatctacgcatcg
gagagcctgtttcgcgccggcatccggccgaccaccgcggcggggcgcgtctcgctcgtg
cgttacgagctgttggcggacgccgtgcgcgtgacgctcgccgccgcgatcgagaaggga
ggcagcacgttgcgcgacttcgtcggcagcaacggcgaaagcggttacttccagctcgac
tatttcgtctatgatcgcgcgggactgccatgccgcgtgtgtggaacgccgatcaaacag
atcgtgcaagggcagcgttcaacgtatttctgtcccacctgccagcgctaa

DBGET integrated database retrieval system