KEGG   Burkholderia phytofirmans: Bphyt_0743Help
Entry
Bphyt_0743        CDS       T00765                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpy  Burkholderia phytofirmans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(822037..822585)
Genome map
AA seq 182 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQHTISVLAKSSLYRTAPIDAGGDDYFNCVVKI
DTTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLFGDQSIDEADLIVPHPRLVER
AFALVPLVEIDPSLVIPQHGRAEALLSGVSDQRIKKVKGPCQCPMLNALAAGESTTPKGR
CE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcggcctcggcgcgaatctcggggacgcgcgccagaccctgaaa
gacgcggtggtgtgcctcgcacaacagcacaccatctccgtgctcgccaagtcgagcctg
tatcgcactgccccgatcgacgcgggcggcgacgattatttcaactgcgtcgtgaagatc
gatacgacgctccccgtgcggcatctgcttgcgctctgccacaaaatcgagcatcagttc
ggccgcgagcggccgtttcgcaacgcaccgcgcacgctcgatctggacatcctgctgttc
ggcgatcaatcgatcgacgaagccgatctgatcgtgccgcatccacgcttggtcgaacgc
gcattcgcgctggtgccgctcgtcgaaatcgatccctcactcgtgatcccgcagcacggc
cgtgccgaagcgctgcttagcggcgtgagcgatcagcgcatcaagaaagtgaaggggcct
tgccagtgccccatgctaaatgcattggccgcaggtgaaagcaccactcctaaaggccgt
tgcgaatga

DBGET integrated database retrieval system