KEGG   Burkholderia phytofirmans: Bphyt_0920Help
Entry
Bphyt_0920        CDS       T00765                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpy  Burkholderia phytofirmans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_0920
   00030 Pentose phosphate pathway
    Bphyt_0920
   00051 Fructose and mannose metabolism
    Bphyt_0920
   00052 Galactose metabolism
    Bphyt_0920
   00500 Starch and sucrose metabolism
    Bphyt_0920
   00520 Amino sugar and nucleotide sugar metabolism
    Bphyt_0920
  Nucleotide metabolism
   00230 Purine metabolism
    Bphyt_0920
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bphyt_0920
Enzymes [BR:bpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bphyt_0920
    5.4.2.8  phosphomannomutase
     Bphyt_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1033928..1035322
Genome map
AA seq 464 aa AA seqDB search
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVQA
LSDGLREAGVDVVNVGMVPTPVGYFAASVPLQLDGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQILALHQRIVDENFSTGSGTYTEYDIADAYLERITSDIKLARPIKIVVDT
GNGVAGGLAPKLFKKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGEIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVEDP
SKLLNSLPNSNSTPELQLKLEEGENFELIARLQQNAKFTGADDVVKIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVIMAEKPDAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaaatctattttcaaggcgtatgacattcgcggtgtaatcggcaagacgctc
gacgccgatgcagcgcgttcgatcggccgcgcgttcggcagcgaagtgcgggcccaaggc
ggcgacgccgtggtggtcgcgcgtgacggccgcctgtcgggtcccgagctggtccaggct
ttgtcggacggtctgcgtgaagccggcgtcgacgtggtcaacgtgggcatggtgcccacc
ccggtcggctacttcgcggccagcgtgcccttgcagctcgacggcggcgagcgccgcgtc
gattcgtgcatcgtcgtgacgggtagtcataatccgccggactataacggcttcaagatg
gtcctgcgcggcgcggcgatttacggcgagcagattctcgcgctgcatcagcgcatcgtc
gacgagaacttctccacaggcagcggcacgtacaccgagtacgacatcgccgacgcctat
ctcgaacgcatcacgagcgacatcaagctcgcgcgtcccatcaagatcgtggtcgacacc
ggcaacggcgtggccggtggtctcgcgcccaagttgttcaagaagctcggctgcgaactg
gtcgaactgttcaccgagatcgacggcaacttcccgaatcatcacccggacccggctcac
ccggaaaacctgcaggacgtgatccgcgcgctgaaggaaacggacgctgaaatcggcttc
gcgttcgacggcgacggcgaccgcctgggcgtggtcaccaaagacggcgagatcatttat
ccggaccgtcagctcatgctgttcgccgaagaagtgctgtcgcgcaacaagggcgcgcag
atcatttacgacgtgaagtgcacgcgtaacctcgccaagtgggtgaaggacaagggcggc
gagccgctcatgtggaagaccggccactcgctcgtcaaggcgaagctgcgtgaaaccggc
gcgccgctggcaggcgaaatgagcggccacgtgttcttcaaggaccgctggtacggtttc
gacgacggcctgtacaccggagcgcgcctgctcgaaatcctcacgcgtgtggaagacccg
agcaagctgctgaactcgctgccgaactcgaactccacgccggaactgcaactgaagctc
gaggaaggcgaaaacttcgaactgatcgcgcgcctccagcaaaacgcgaagttcaccggc
gcggacgacgtggtgaagatcgacggcctgcgcgtcgagtatccagacggcttcggtctc
gcgcggtcgtcgaacaccacgccggtcgtggtgatgcgtttcgaagccgataacgacgcg
gcgctcaagcgcatccaggaagacttccgccgcgtgatcatggcggaaaagcctgacgca
aagctgccgttctaa

DBGET integrated database retrieval system