KEGG   Burkholderia phytofirmans: Bphyt_1041Help
Entry
Bphyt_1041        CDS       T00765                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bpy  Burkholderia phytofirmans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bphyt_1041
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Bphyt_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1174027..1175016
Genome map
AA seq 329 aa AA seqDB search
MNTSSFISPEAGERPQPLSGNAMPRCGGIATMMRLPNVGSAEGFDACFVGVPFDLGTSNR
TGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIKRIETAYDE
ILQHDCKPITLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRR
AVEEGLLDCDRVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLVPLMARIRERMG
DGPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGSRGLNIVGCDLVEVAPPYDP
FGTTALLGANLAFELLCVLPGVEYRASTR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcttccttcatttccccagaagccggcgaacggccgcaaccgctgtccggc
aacgccatgccccgctgcggcggcatcgcgacgatgatgcggctgccgaacgtcggctcg
gccgaaggcttcgacgcctgtttcgtcggcgtgccgttcgatctcggcacctcgaaccgg
accggcgcgcgcttcggaccgcgccagatccgcagtgaatccgtgctgctgcgcccgtac
aacatggcgacgcgcgccgcgccgttcgattcgctgcgcgtggccgacctcggcgacgtc
gcgatcaatccgtacaacctgcacgattccatcaagcgcatcgaaaccgcgtacgacgaa
attcttcaacacgattgcaagccgatcacgctgggcggcgatcacaccatcgcgctgccg
atcctgcgcgcgattcatcgcaagcacggcaaggtcggcctgattcacgtcgacgcgcac
gccgacgtcaacgacaccatgatgggcgagaagatcgcgcacggcacgccgttccgccgc
gcggtggaagagggcttgctcgattgcgaccgtgtcgtgcagatcggtttgcgcggcacg
ggctacgcagccgaagacttcgactggtgccgcgatcagggttttgaagtcgtgcaggcc
gaggcttgctggaaccagtcgctcgtgccgttgatggcgcgtattcgcgagcgcatgggc
gacggcccggtgtacatcacgttcgacatcgacgggatcgatccggcttttgcgccgggc
acgggcacgccggaaatcgccggcttgacggtgccgcaggcgttggaaatcattcgcggc
tcgcgtggtctgaatatcgtcggctgcgatctggtcgaggtcgcgccgccttacgatccg
ttcggcacgaccgcgctgctcggcgcgaatctcgcgttcgaattgctgtgcgtgctgccg
ggtgtcgagtatcgggcgtccacgcgctaa

DBGET integrated database retrieval system