KEGG   Burkholderia phytofirmans: Bphyt_1185Help
Entry
Bphyt_1185        CDS       T00765                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpy  Burkholderia phytofirmans
Brite
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Bphyt_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1327917..1328444
Genome map
AA seq 175 aa AA seqDB search
MSLTENAETLVLFAYPDPASPLAKALQARGLWQRVLAGGAIPPDLGSLNGAPWTGGWGHT
GPDVRPGMTITRDMAVDWLRADVRGAEAVVKRDVKVALNQEEYDALVDLVFNIGSGNFDT
STLLRKLNASDTDGAIAEFARWNQAGGKVLVGLVKRREAERVLFQLGANHARAAA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacggagaacgcagagacgcttgtgctgttcgcgtatccggatccagcgtcg
ccactcgccaaagccctgcaggcgcggggcctatggcagcgggtgctcgctggcggtgcg
attccgcctgacctcggctcgctgaacggtgcgccgtggacaggcggctggggccatacc
ggcccggacgtcaggcccggcatgacgatcacgcgcgacatggccgtcgactggttgcgc
gcggacgtgcgcggtgccgaagccgtggtcaaacgcgacgtcaaggttgctttgaaccag
gaggaatacgacgcactcgtcgacctcgtattcaacatcggcagcggcaatttcgacacc
tcgacgcttttgcgcaagctcaacgccagcgacacggacggcgcaatcgccgaattcgca
cgctggaatcaggcgggcggcaaggtgctggtggggctagtcaagcggcgcgaagcagag
cgcgtgctgttccagctcggcgcaaatcacgcgagggccgccgcatga

DBGET integrated database retrieval system