KEGG   Paraburkholderia phytofirmans: Bphyt_1341Help
Entry
Bphyt_1341        CDS       T00765                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00010  Glycolysis / Gluconeogenesis
bpy00051  Fructose and mannose metabolism
bpy00562  Inositol phosphate metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01200  Carbon metabolism
bpy01230  Biosynthesis of amino acids
Module
bpy_M00002  Glycolysis, core module involving three-carbon compounds
bpy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_1341
   00051 Fructose and mannose metabolism
    Bphyt_1341
   00562 Inositol phosphate metabolism
    Bphyt_1341
Enzymes [BR:bpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bphyt_1341
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bphyt_1341
  Exosomal proteins of bladder cancer cells
   Bphyt_1341
  Exosomal proteins of melanoma cells
   Bphyt_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACD15756
JGI: Bphyt1341
UniProt: B2T2E5
Position
1:1501599..1502378
Genome map
AA seq 259 aa AA seqDB search
MSKQRAKLVVGNWKMHGRLAENATLLQAVAHGAGELPADVRVGVCVPSPYLAQSQSLLEG
SRVVWGVQDVSAFTHGAYTGEVAAPMVVDFGATLAIVGHSERRAYHRESAELVAVKTQRA
LEAGLTPIVCVGETLEEREAGLTEQVVGTQLDEVLAKLSVQEAARLVVAYEPVWAIGTGK
SASSEQAQAVHAFLRARLAAKGAAVADVPLLYGGSVKPENAEELFRQPDIDGGLIGGASL
KDQDFLAICKAAAATSVAG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgagccaagctggtagtcggtaactggaagatgcacgggcgcctcgcc
gaaaatgccacgttgctgcaagcggtggcgcatggtgcgggcgaattgccggccgacgtg
cgcgtcggcgtctgcgtgccgagtccgtatctcgcgcagtctcaatcgttgctggaaggc
agccgggtggtatggggcgtgcaggacgtgtcggcattcacgcatggcgcctataccggt
gaagtggccgcgccgatggtggtggatttcggtgccacgctcgcgatcgtcgggcactcg
gagcgccgtgcctatcatcgcgaaagcgctgaactggttgcggtgaagacgcagcgcgcg
ttggaagcagggttgacgccgatcgtctgcgtcggcgaaacgcttgaagagcgcgaagcc
ggtttgaccgagcaggtggtcggcacgcaactggacgaagtgctggcgaaattgtcggtg
caagaggcggcgcggcttgtcgtcgcatacgagccggtctgggcgatcggtaccggcaag
agcgcgagttcggagcaggcgcaggcggtccatgcgttcctgcgtgcgcgtctggcggca
aagggcgcggcggtggcggatgtcccgctgttgtacggcggtagtgtaaagccggagaac
gcggaagaattgttccgccagccggatatcgacggtggcctgatcggcggcgcgtcgttg
aaagaccaggatttcctggcgatctgcaaggcggcggccgcaacgagcgtggccggttaa

DBGET integrated database retrieval system