KEGG   Paraburkholderia phytofirmans: Bphyt_1341Help
Entry
Bphyt_1341        CDS       T00765                                 

Definition
(GenBank) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphyt_1341
   01230 Biosynthesis of amino acids
    Bphyt_1341
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_1341
   00051 Fructose and mannose metabolism
    Bphyt_1341
   00562 Inositol phosphate metabolism
    Bphyt_1341
Enzymes [BR:bpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bphyt_1341
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bphyt_1341
  Exosomal proteins of bladder cancer cells
   Bphyt_1341
  Exosomal proteins of melanoma cells
   Bphyt_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1501599..1502378
Genome map
AA seq 259 aa AA seqDB search
MSKQRAKLVVGNWKMHGRLAENATLLQAVAHGAGELPADVRVGVCVPSPYLAQSQSLLEG
SRVVWGVQDVSAFTHGAYTGEVAAPMVVDFGATLAIVGHSERRAYHRESAELVAVKTQRA
LEAGLTPIVCVGETLEEREAGLTEQVVGTQLDEVLAKLSVQEAARLVVAYEPVWAIGTGK
SASSEQAQAVHAFLRARLAAKGAAVADVPLLYGGSVKPENAEELFRQPDIDGGLIGGASL
KDQDFLAICKAAAATSVAG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgagccaagctggtagtcggtaactggaagatgcacgggcgcctcgcc
gaaaatgccacgttgctgcaagcggtggcgcatggtgcgggcgaattgccggccgacgtg
cgcgtcggcgtctgcgtgccgagtccgtatctcgcgcagtctcaatcgttgctggaaggc
agccgggtggtatggggcgtgcaggacgtgtcggcattcacgcatggcgcctataccggt
gaagtggccgcgccgatggtggtggatttcggtgccacgctcgcgatcgtcgggcactcg
gagcgccgtgcctatcatcgcgaaagcgctgaactggttgcggtgaagacgcagcgcgcg
ttggaagcagggttgacgccgatcgtctgcgtcggcgaaacgcttgaagagcgcgaagcc
ggtttgaccgagcaggtggtcggcacgcaactggacgaagtgctggcgaaattgtcggtg
caagaggcggcgcggcttgtcgtcgcatacgagccggtctgggcgatcggtaccggcaag
agcgcgagttcggagcaggcgcaggcggtccatgcgttcctgcgtgcgcgtctggcggca
aagggcgcggcggtggcggatgtcccgctgttgtacggcggtagtgtaaagccggagaac
gcggaagaattgttccgccagccggatatcgacggtggcctgatcggcggcgcgtcgttg
aaagaccaggatttcctggcgatctgcaaggcggcggccgcaacgagcgtggccggttaa

DBGET integrated database retrieval system